KEGG   Burkholderia sp. 383: Bcep18194_B0775Help
Entry
Bcep18194_B0775   CDS       T00286                                 

Definition
cytochrome P450-like (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bur  Burkholderia sp. 383
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bur00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bur00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bur00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:879946..881121
Genome map
AA seq 391 aa AA seqDB search
MNPTDPIAAVTHRDPYPYYAALVDGPPLAFDATLGLWVASRAAAVTAVLGHPACRVRPLD
APVPPALRGTTAGALFGELVRMNDGALRHDVPKQALRTAFAPIDTVALRDRVTQLAARRL
PTPGDAGALNAWCMTVPVCAVADLLGFDDTQLDDIAGLVVDFVAALSPLSDAVALARASD
AARQLLDRMTARVAQSHAHDGTLVAAVQQAARVSGWQASGGLVANLVGLLSQTCEATAAW
LGNTLVAWSGDASASAARVVPDDAALDAFVAEVGRFDSPVQNTRRFVASRTTIEGVTVEA
GDAILVVLAAANRDPAVHRDPHRFMPGRAAGPNFGFGTGPHGCPGERIARAVTAGAFGAW
LRAGGVAPHDGLAWDYRASTNVRMPKFDAAR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccgatcccatcgcagcggtcacgcaccgcgatccctatccctactatgcg
gcgctcgtcgacgggccgccgctcgcgttcgacgccacgctcggcctgtgggtcgcgagc
cgcgcggccgccgtgacggccgtgctcggccatccggcctgccgggttcgcccgctggac
gcacccgtgccgcccgcgttgcgcggcacgacggccggcgcgttgttcggcgagctggtg
cgcatgaacgacggcgcgctgcggcacgacgtgccgaagcaggcgctgcgcacggcgttc
gcgccgatcgacacggtcgcgttgcgtgaccgtgtcacgcagcttgccgcgcggcgcttg
ccgacgccgggcgatgccggcgcgctgaacgcatggtgcatgacggtgcccgtttgcgcg
gttgccgatctgctcggcttcgacgacacgcagctcgacgatattgcgggcctggtcgtc
gatttcgtcgccgcgctgtcgccgctgtcggatgccgtggcgctggcccgcgcgagcgac
gccgcgcggcaactgctcgaccggatgacggcgcgcgtcgcgcagtcgcatgcgcacgac
ggcacgctcgtcgccgcggtgcagcaggcggcccgcgtgtcgggctggcaggcgagcggc
gggctggtcgcgaatctcgtcgggctgttgtcgcagacctgcgaggcgactgccgcgtgg
ctcggcaatacgctggtggcgtggagcggggacgcgagcgcgagcgctgcgcgtgtggtt
ccggacgatgctgcgctcgacgcattcgttgccgaagtcgggcgcttcgattcgccggtg
cagaacacgcgccgcttcgtcgcatcgcgcacgacgatcgaaggcgtgaccgtcgaagcc
ggcgacgcgattctcgtcgtgcttgccgccgcgaaccgcgacccggccgtgcatcgcgat
ccgcaccggttcatgcctggccgcgcggccgggccgaatttcggcttcggcacggggccg
catggttgcccgggcgagcggatcgcgcgggcggtgacggcgggggcattcggggcgtgg
ctgcgtgcgggcggtgtggcaccgcacgacgggctggcgtgggactaccgcgcgtcgacc
aacgtcaggatgccgaagttcgacgcggcacggtga

DBGET integrated database retrieval system