KEGG   Burkholderia lata: Bcep18194_B1187Help
Entry
Bcep18194_B1187   CDS       T00286                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bur  Burkholderia lata
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcep18194_B1187
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep18194_B1187
   00650 Butanoate metabolism
    Bcep18194_B1187
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bcep18194_B1187
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep18194_B1187
   00622 Xylene degradation
    Bcep18194_B1187
   00621 Dioxin degradation
    Bcep18194_B1187
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bcep18194_B1187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1335568..1336527
Genome map
AA seq 319 aa AA seqDB search
MKSKAKVAIIGPGNIGTDLMIKVMRHGTHIEMGAMIGVDPKSDGLARAQRMGVAISSDGI
DGLLALDVFKEIDIVFDATSAGAHKRHNDVLQAHGVQVIDLTPAAIGPYVIPAINLESEN
APNMNMVTCGGQATIPMVAAISRVTKVHYAEIVASISSKSAGPGTRANIDEFTETTRKAI
EQLGGASRGKAIIILNPAEPPLIMRDTVFALSDPADQGKIEDSIAQMVASVQAYVPGYRL
KQKVQFDVITADKPLNVPGVGLKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRMAAGIARGHKEAV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcaaaagcgaaagtggcgatcatcgggccgggaaatatcggcacggacctgatg
atcaaggtgatgcgtcacggcacgcacatcgaaatgggcgcgatgatcggcgtcgatccg
aagtcggacggcctcgcgcgcgcgcagcgcatgggtgtcgcgatctcgtcggacggtatc
gacgggttgctggcgctcgacgtgttcaaggagatcgacatcgtgttcgacgcgacgtcg
gccggcgcgcacaagcggcacaacgacgtgttgcaggcgcatggtgtgcaggtgatcgac
ctgacgccggccgcgatcggcccgtatgtgattccggccatcaacctggaatcggaaaat
gcgccgaacatgaacatggtgacgtgcggcggccaggcgacgatcccgatggtcgccgcg
atatcgcgcgtgacgaaggtgcattacgcggaaatcgtcgcgtcgatctcgagcaagtcg
gcggggcccggcacgcgcgcgaacattgacgaattcaccgagacgacgcgcaaggcgatc
gagcagctcggcggcgcgtcgcgcggcaaggcgatcatcatcctcaatcctgccgagccg
ccgctgatcatgcgcgacacggtgttcgcgctgtccgatcctgccgatcagggcaagatc
gaggacagcatcgcgcagatggtggcgagcgtgcaggcgtacgtgccgggctatcggctc
aagcagaaggtccagttcgacgtgatcacggccgacaagccgctcaacgtgccgggcgtc
gggctgaagcacggattgaagacgtcggtgttcctcgaggtcgagggcgcggcgcactac
ctgccgtcgtatgccggcaacctcgacatcatgacctcggccgcactcgcatgcggcgac
atgatggcgcgcagaagaatggccgcgggcattgcgcgcggtcacaaggaggcagtgtga

DBGET integrated database retrieval system