KEGG   Burkholderia lata: Bcep18194_B1689Help
Entry
Bcep18194_B1689   CDS       T00286                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
bur  Burkholderia lata
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_B1689
  Amino acid metabolism
   00380 Tryptophan metabolism
    Bcep18194_B1689
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcep18194_B1689
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Bcep18194_B1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1918875..1920173)
Genome map
AA seq 432 aa AA seqDB search
MSRDLLGTLAGWQRTYGDVVHLRVRPEHAVVVTDPALVRELLVTHHDALGRWERAIRVFA
QVHGHSVLVAEGDAWRDKRQALQPNFMPKPVQAFVPSIAATAGHALAQWPARDPDWPIES
ALTSLAMDVIMRTMFSDAIGDDARAAEEAVRTVSAAANADFYWPASTPDWVPWKRGKARA
MAVLNGLIDRQLHARLDLPARAWPDDLLSRLLRLHRDDARRWPLQAVHDECMTAFLAGHE
TTAGALTWWAWCMATNPAAQAAARDEVSRVLGGCAPSAETRSSLRYLTHTLEETLRLYPS
APILISRRASRPIVLGPWQFPARTLFMLPLQLMQRDARWFAEPDVFRPERFADGAPAAPR
GTYMPFGTGPRVCLGQHLAMTEMTVVAAMILQRYELSAQPGMMPPRPVLNVTLRPERLLH
LAIAPAADGGTV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgacctgctcggcacacttgccggctggcagcgtacctacggcgacgtcgtg
cacttgcgcgtacggcccgagcatgcggtggtcgtgaccgaccccgcgctcgtgcgcgaa
ctcctggttacgcatcacgatgcgctcgggcgctgggagcgagccatccgggtgttcgcg
caggtccacggccatagcgtgctggtcgccgaaggcgatgcgtggcgcgacaagcggcag
gcgttgcaaccgaatttcatgccgaagccggtgcaggcgttcgtaccttcgatcgcggcg
acggccggacatgcgctcgcgcagtggcccgcgcgcgatccggactggccgatcgaaagc
gcgctgacgtcgctggcgatggacgtgatcatgcgcacgatgttttccgacgcgatcggc
gacgatgcgcgtgcagccgaggaagccgtgcgcacggtgagcgcggcagccaacgccgat
ttctactggcccgcgagcacgccggactgggtgccgtggaagcgcggcaaggcgcgggcg
atggccgtgctgaacgggctgatcgatcggcaactgcatgcgcgtctcgacctgccggcg
cgtgcgtggcccgacgatctgctgtcgcgcctgttgcgactgcatcgggacgacgcgcgg
cgatggccgttgcaggcggtgcacgacgaatgcatgaccgcgttcctcgccggccacgag
acgacggccggggcgctgacctggtgggcgtggtgcatggcaacgaatccggcggcgcag
gccgccgcgcgcgacgaggtgtcgcgtgtactaggcggttgcgcaccgtccgccgagacg
cgatcgtcgttgcgctacctgacgcacacgctcgaggaaacgctgcgcctctatccttcc
gcgccgatcctgatcagccgccgcgcgtcgcggccgatcgtgctgggaccgtggcagttt
cccgcgcggacgctgttcatgctgccgctgcaactgatgcagcgcgatgcgcgatggttt
gcggagcctgacgtgttccgtcccgagcgttttgcggacggcgcgccggccgcgccgcgc
ggaacctacatgccgttcggcacggggccgcgcgtgtgtctcgggcagcatctggcgatg
acggaaatgacggtcgtcgcggcgatgatcctgcagcgctacgaattgtcggcgcagccc
ggcatgatgccgccgcggccggtgctgaacgtgacgctgcggccggagcggctgctgcat
ctcgcgatcgcgcccgccgcggacggcggtaccgtgtga

DBGET integrated database retrieval system