KEGG   Burkholderia lata: Bcep18194_B2017Help
Entry
Bcep18194_B2017   CDS       T00286                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
bur  Burkholderia lata
Pathway
bur02020  Two-component system
bur02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bur00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcep18194_B2017
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bcep18194_B2017
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcep18194_B2017
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Bcep18194_B2017
Two-component system [BR:bur02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bcep18194_B2017
Bacterial motility proteins [BR:bur02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcep18194_B2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABB12130
UniProt: Q394I6
Position
2:2310358..2311362
Genome map
AA seq 334 aa AA seqDB search
MNIGIVNDLPLAVEAMRRAIARRPEHRVLWVATDGAQAVELCAAQPPDVVLMDLIMPKFD
GIEATRRIMRSERPCAILIVTSCIGANAWRVFEAMGAGALDAVDTPRLGDGAAGDTTKLL
LAKIDQIGRLLDAPGGTRLAGTAARAGGGPLIAIGASAGGPGALASILGGLPADFSAPIV
IVQHVDRAFAEGMAQWLDGQTPLAVRVAREGDRPQPGVALLAATDDHLRITRAGTLEYTR
EPAATPYRPSVDVFFNSLTEHWPGRVIGVLLTGMGRDGAIGLKALRMKGYHTIAQDEATS
AVYGMPKAAATLGAARAILPLGRIAGELAALARI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatcggcatcgtcaacgacctcccgcttgccgtcgaggcgatgcgccgcgcgatc
gcgcgccggcccgagcaccgcgtgctgtgggtcgcgaccgacggcgcgcaagccgtcgag
ctgtgcgccgcgcagccgcctgatgtcgtgctgatggacctgatcatgccgaaattcgac
gggatcgaagcaacgcggcggatcatgcgatccgaacgaccgtgcgcgatcctgatcgtg
acgagctgcatcggcgcgaatgcatggcgcgtgttcgaggcgatgggcgccggcgcgctc
gacgcggtcgatacgccgcggctcggcgacggcgcggccggtgacacgaccaaactgctg
ctcgcgaagatcgaccagatcggccgcctgctcgacgcacccggcggcacgcgcctcgcc
ggcacggccgcgcgcgccggcggtggcccgctgatcgcgatcggcgcatcggccggcggc
cccggcgcactcgcgtcgatcctcggcggtctgccggccgatttcagtgcgccgatcgtg
atcgtccagcacgtcgaccgcgcgttcgccgaaggcatggcgcaatggctcgatggccag
acgccgctcgccgtgcgcgtcgcgcgcgaaggcgaccgcccgcagccgggcgtcgcgctg
ctcgccgcgaccgacgaccacctgcgcatcacgcgcgccggcacgctcgaatacacgcgc
gagccggccgccacgccgtatcgcccgtcggtcgacgtgttcttcaacagcctcaccgag
cactggcccggccgcgtgatcggcgtgctgctcacggggatgggacgcgacggcgcgatt
ggcctgaaggcgctgcggatgaagggctaccatacgatcgcgcaggacgaggcgacgagc
gccgtgtacggcatgccgaaggcggccgcgacactcggcgcggcgcgcgcaatcctgccg
ctcgggcgcatcgcgggcgagctggcggcgctcgcgagaatctga

DBGET integrated database retrieval system