KEGG   Burkholderia lata: Bcep18194_B2109Help
Entry
Bcep18194_B2109   CDS       T00286                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bur  Burkholderia lata
Pathway
bur00040  Pentose and glucuronate interconversions
bur00052  Galactose metabolism
bur00500  Starch and sucrose metabolism
bur00520  Amino sugar and nucleotide sugar metabolism
bur01100  Metabolic pathways
bur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bcep18194_B2109
   00052 Galactose metabolism
    Bcep18194_B2109
   00500 Starch and sucrose metabolism
    Bcep18194_B2109
   00520 Amino sugar and nucleotide sugar metabolism
    Bcep18194_B2109
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bcep18194_B2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABB12220
UniProt: Q393Z6
Position
2:complement(2414876..2415763)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggccgtgttccccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgttgcccgtcgtcgacaagccgctgattcagtac
gcggtcgaggaagcgatcaacgcaggtatcaccgagatgatcttcgtcaccgggcgcagc
aagcgcgcgatcgaggatcacttcgacaagtcctacgagatcgaggccgagctcgaggca
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtgaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccacgcggtgctgtgtgcggagaag
ctggtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcatggcgaacag
ccggtgctgaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgttcgtacggcgtcgtcgaaggccgcgaatgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaagatgcgccgtcg
aatctcggcgtggtcggccgctacgtgttcatgccgacgatcttcgatcacctgcgcaag
ctcaagccgggcgccggcggcgagctgcagctgaccgatgcggtccagtcgctgctcgcg
aacgagcaggtgctcgcgtatcgctacttcggcacgcgcttcgattgcggcagcaagatc
ggctatctcaaggccaccgttgaactcgcgctccagcatcctgaagtgagccgcgaattc
gaggcctacctgcgtacctgtttgcccgcgctggctgctgtcgcctaa

DBGET integrated database retrieval system