KEGG   Burkholderia lata: Bcep18194_B2123Help
Entry
Bcep18194_B2123   CDS       T00286                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep18194_B2123
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_B2123
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep18194_B2123
Enzymes [BR:bur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcep18194_B2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(2434675..2435490)
Genome map
AA seq 271 aa AA seqDB search
MNRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAEGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYANPIERMGVDTFAAEAQA
AGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAAAALKTFIAELRAALDGAGKTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattcagcagaccttcgccgcgctcgccgaacaaggccgtaagggcctgatc
ccgttcatcacggccggcgaccccgatcccgccaagaccgtcgaattcatgcatgcgctc
gccgaaggcggcgcggacgtgatcgaactcggcgtgccgttctcggacccgatggccgac
ggccccgtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgctcaagagc
gtgctcgccgacgtgaagcgttttcgcgaaaccgaccccaaaactcccgtcgtgctgatg
ggctatgcgaacccgatcgagcggatgggtgtcgacacgttcgcggccgaagcccaggcg
gccggggtcgacggcgtgctcgtcgtcgactatccgccggaagaagcgggcgtgttcgcc
gagaaaatgcgtgccgcgcagatcgatccgatcttcctgctcgcgcccacgtcgaccgac
gaacgcatcgccgacgtcggcaagatcgcgagcggctacgtgtactacgtgtcgctcaag
ggcgtgaccggcgcaggaaatctggatgtttcgagcattgcgggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtcggcgtcggcttcggtatccgcgacgccgaaacggcg
cgcgcagtggccgaagtgtcggacgccgtcgtgatcggcagccgcctcgtgcagctgctc
gaaagcgctgcgccggagggtgccgccgccgcgctgaagactttcattgccgagctgcgt
gccgccctggacggcgcgggcaagacggcgcgataa

DBGET integrated database retrieval system