KEGG   Burkholderia lata: Bcep18194_B2125Help
Entry
Bcep18194_B2125   CDS       T00286                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bur  Burkholderia lata
Pathway
bur00260  Glycine, serine and threonine metabolism
bur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bur01100  Metabolic pathways
bur01110  Biosynthesis of secondary metabolites
bur01130  Biosynthesis of antibiotics
bur01230  Biosynthesis of amino acids
Module
bur_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_B2125
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep18194_B2125
Enzymes [BR:bur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcep18194_B2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABB12236
UniProt: Q393Y0
Position
2:complement(2436440..2437633)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGTFVAETLIHALDELRAAYEKFQNDPDFVAEFERELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccacttcggcccgtatggcggcacgtttgtcgcc
gagacgctgattcacgcgctggacgaactgcgcgcggcgtatgaaaaattccagaacgat
cccgatttcgtcgccgaattcgagcgcgagctgaagcatttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggttcggaa
gacgtgcgccgccaggccgcgaacgtctaccggatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgagaacacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccg
gaaatgaccggccggcagcctgacgcggtgatcgcctgcgtgggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgacacctcggtgcagttgatcggcgtcgaagca
gccggcgacggcctcgacacgggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgtacctacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgactatccgggcgtcggccccgagcacgcgtggctgaag
gatagcggccgtgcgcagtacgtcggcatcaccgacgaggaagcgctgaaggcgttccac
gactgctgccggatcgaggggatcattcccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgaactctga

DBGET integrated database retrieval system