KEGG   Burkholderia lata: Bcep18194_B2125Help
Entry
Bcep18194_B2125   CDS       T00286                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcep18194_B2125
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_B2125
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcep18194_B2125
Enzymes [BR:bur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcep18194_B2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(2436440..2437633)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGTFVAETLIHALDELRAAYEKFQNDPDFVAEFERELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccacttcggcccgtatggcggcacgtttgtcgcc
gagacgctgattcacgcgctggacgaactgcgcgcggcgtatgaaaaattccagaacgat
cccgatttcgtcgccgaattcgagcgcgagctgaagcatttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggttcggaa
gacgtgcgccgccaggccgcgaacgtctaccggatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgagaacacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccg
gaaatgaccggccggcagcctgacgcggtgatcgcctgcgtgggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgacacctcggtgcagttgatcggcgtcgaagca
gccggcgacggcctcgacacgggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgtacctacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgactatccgggcgtcggccccgagcacgcgtggctgaag
gatagcggccgtgcgcagtacgtcggcatcaccgacgaggaagcgctgaaggcgttccac
gactgctgccggatcgaggggatcattcccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgaactctga

DBGET integrated database retrieval system