KEGG   Burkholderia lata: Bcep18194_B2520Help
Entry
Bcep18194_B2520   CDS       T00286                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:2867226..2867870
Genome map
AA seq 214 aa AA seqDB search
MIRVILADDHAVMRDGLRYILETAGGFEIVGEASDGSATLALVERGAADVLLLDLSMPAP
TGIELIRLVKRQAPSLRTLVLTMHAEAQYAARAFKAGATGYLTKDSATAELVEAVGKVAA
GGVYVSPSAAESLALTLRTPAATLPHERLSARELDVMRRIVAGQTVTQIATELALSAKTV
STYKTRILEKMELPHEAALVRYAVRHDLDPGGDA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatcagggtaattctggctgacgatcacgcagtcatgcgggacggactgcgctacatc
ctggaaacggccggcggtttcgaaatcgtcggcgaggcgagcgacggctcggccacgctt
gcgctggtcgagcgcggcgccgccgacgtgctgctgctcgacctgtcgatgcccgcgccg
accggcatcgagctgatccggctggtgaagcgccaggcgccgtcgctgcgcacgctcgtg
ctgacgatgcatgcggaggcgcagtacgcggcgcgcgcgttcaaggccggcgcaaccggc
tacctgacgaaggacagcgcgaccgccgagctcgtcgaggcggtcggcaaggtggccgcg
ggcggcgtctatgtgagcccgtcggcggcagaaagcctcgcgctcacgctgcgcacgccg
gccgcgacgcttccgcacgaacggctgtccgcgcgcgagctcgacgtgatgcgccgcatc
gtcgcgggccagaccgtcacgcagatcgcgaccgaactcgcgctcagcgcgaagacggtc
agcacgtacaagacacggattctcgagaagatggagctgccgcacgaagccgcgctggtt
cgctacgcggtgcgccacgacctcgaccccggcggcgacgcatga

DBGET integrated database retrieval system