KEGG   Burkholderia lata: Bcep18194_B2787Help
Entry
Bcep18194_B2787   CDS       T00286                                 

Definition
(GenBank) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
bur  Burkholderia lata
Pathway
bur00330  Arginine and proline metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcep18194_B2787
Enzymes [BR:bur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bcep18194_B2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh UPF0489
Motif
Other DBs
NCBI-ProteinID: ABB12898
UniProt: Q391G8
Position
2:3157035..3157985
Genome map
AA seq 316 aa AA seqDB search
MPRELNQPMGGNEMPRFGGIATMMRLPQAETTDGLDVCFVGVPLDLGTSNRSGSRFGPRQ
IRTESVLLRPYNMATRAAPFDSLQVADIGDVATNPYDLKDSVRRIEEAYDEIVANGCRPI
TLGGDHTIAWPILRALHKKYGQVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVEDGLLQC
NKVTQIGLRGTGYHADDFDWCRQQGFTVVQAEECWNKSLAPLMAQVRERVGDTPVYLSFD
IDGLDPSFAPGTGTPEIGGLTVQQGLEIVRGMKGLNIVGADLVEVAPPYDPTGTTALTGA
NLAFEMLCVMPGVAYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgaactgaatcaaccgatgggcggcaacgagatgccgcgctttggcggcatc
gccacgatgatgcggctgccgcaagccgaaacgaccgacggcctcgacgtgtgcttcgtc
ggcgtgccgctcgacctcggcacgtcgaaccgctcgggctcgcgcttcggcccgcgccag
atccgcaccgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcagcaccgttc
gattcgctgcaggtggccgacatcggcgacgtcgcgaccaacccgtacgacctgaaggac
tcggtgcgccgcatcgaagaggcgtacgacgagatcgtcgcgaacggctgccggccgatc
acgctcggcggcgaccacacgattgcgtggccgatcctgcgcgcgctgcacaagaaatac
ggccaggtcgccgtcgtgcacgtcgacgcgcatgcggacgtgaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgttccgccgcgcggtggaagacggcctgctgcaatgc
aacaaggtcacgcagatcggcctgcgcggcaccggctaccacgcggacgatttcgactgg
tgccgccagcagggcttcaccgtcgtgcaggcggaagaatgctggaacaaatcgctcgcg
ccgctgatggcgcaggtgcgcgaacgcgtcggcgacacgccggtctacctgagcttcgac
atcgacggcctcgatccgtcgttcgcgcccggcaccggcacgccggaaatcggcggcctc
accgtgcagcaaggtctcgagatcgtgcgcgggatgaagggcctgaacatcgtcggtgcg
gacctcgtcgaagtcgcgccgccgtacgacccgaccggcaccaccgcgctcaccggcgcg
aacctcgcgttcgagatgctctgcgtgatgccgggcgtcgcctaccgctaa

DBGET integrated database retrieval system