KEGG   Burkholderia lata: Bcep18194_B2852Help
Entry
Bcep18194_B2852   CDS       T00286                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bur  Burkholderia lata
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcep18194_B2852
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcep18194_B2852
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcep18194_B2852
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bcep18194_B2852
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_B2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(3222176..3223567)
Genome map
AA seq 463 aa AA seqDB search
MSTIKCIAAALAVAGFACGAAQAAGQAKNVIFFLGDGMGPTTVTASRIYKVGESGQLTME
KLARTARVKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSSDTRAVAPGNDANGNKTVN
NCVTGNGQPVATLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQASPG
GAGYNAALGDGVDVLMGGGRNHWTPFDPVANKRGRADGRNLLNEMKAKGYTVVANKDQLA
QAGNGKLVGLFSSTSHLEYELDRVAGKGEGPTQPSLAEMTSKAIDVLSKNSNGYFLMVEG
GRIDHALHGTNAKRALEDTAAFDEAIRVALSKVDLSNTLIVVTADHDHTMTINGYSKRGN
PILDISRNYRDGQPSKDADGNTYTTLVFGNGANRPNVRASVDSATATNEAYLQEVGVRMG
SAGSETHGGGDVMLFADGADAKAFKGTIDNTKVFGLVRSAFGF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccatcaagtgcatcgcggcggcgctggccgtcgcgggtttcgcatgcggcgcg
gcgcaggccgccggccaggcgaagaacgtgattttctttctcggcgacggcatggggccg
acgaccgtgacggcgagccggatctacaaggtcggtgagtcgggacaactgacgatggag
aagctggctcgcaccgcgcgcgtcaagaccttctcgaacgacgcgcagacgaccgacagc
gcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgaagtgctgtcgatg
tcgtccgacacgcgcgcggtcgcgccgggcaacgacgccaacggcaacaagaccgtcaac
aactgcgtgacgggcaacggccagccggtcgcgacgctgctggagctcgcgaaagcgcgc
ggcaaggcggtgggtgcgatcacgacgaccgagctcacgcacgcgacgcctgccgcgacc
tattcgcacatctgccatcgcgatgcgcagtacgacatcgccgcgcaggcgtcgccgggc
ggcgcaggctacaacgcggcgctcggcgacggcgtcgacgtgttgatgggcggcggccgc
aaccactggacgccgttcgatccggtggccaacaagcgcgggcgtgcggacggccgcaac
ctgctcaacgagatgaaggcgaagggctacacggtcgtcgcgaacaaggatcagctcgcg
caggccggcaacggcaagctggttggcctcttcagttcgacgagccatctggagtatgaa
ctcgaccgcgtcgcgggcaagggcgaaggtccgacgcagccgagcctcgcggagatgacg
tcgaaggcgatcgacgtgctgtcgaagaattcgaacggctatttcctgatggtcgaaggc
ggccggatcgatcacgcgctgcacggcaccaacgcgaagcgcgcgctggaagacacggcg
gcgttcgacgaagcgatccgcgtcgcgctgtcgaaggtcgacctgtcgaacacgctgatc
gtcgtgacggccgaccacgaccacacgatgacgatcaacggctattcgaagcgcggcaac
ccgattctcgacatcagccgcaactatcgcgacggccagccgagcaaggacgccgacggc
aacacctacacgacgctcgtgttcggcaacggcgcgaaccggccgaacgtgcgcgcgtcg
gtcgattcggccaccgcgacgaacgaggcgtatctgcaggaagtgggcgtgcggatgggc
agcgcgggctcggagacgcacggcggcggcgacgtgatgctgttcgccgacggcgcggac
gcgaaggcgttcaagggcacgatcgacaacacgaaggtgttcggtctcgtgcgctcggcg
ttcggtttctga

DBGET integrated database retrieval system