KEGG   Burkholderia lata: Bcep18194_B3050Help
Entry
Bcep18194_B3050   CDS       T00286                                 

Definition
two component transcriptional regulator (EC:3.1.1.61)
Orthology
K18144  
two-component system, OmpR family, response regulator AdeR
Organism
bur  Burkholderia lata
Pathway
beta-Lactam resistance
Module
Multidrug resistance, efflux pump AdeABC
AdeS-AdeR two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bur00001]
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bcep18194_B3050
Two-component system [BR:bur02022]
 OmpR family
  AdeS-AdeR [MD:M00655]
   Bcep18194_B3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:3446616..3447353
Genome map
AA seq 245 aa AA seqDB search
MAQPDLPTPSSAGQDAQALVLIAEDEPEIAEILTAYLARGGLRTVHAADGRRALELHLQL
KPDLVLLDVQMPHVDGWKVLAEIRHRGDTPVIMLTALDQDIDKLTGLRIGADDYVVKPFN
PAEVVARAQAVLRRSMAGSRQEEQRVLRVAPFEIDLEHHEATLEVGSERHTLVLTLTEFK
LLAQLARAPRRVFSRAELMATCLPEGDALERTVDSHVSKLRKKLDDLGMQGVPVSVRGVG
YKLWS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcctgatctcccgaccccttccagcgccggccaggatgcccaggcgcttgtc
ctcatcgccgaggacgaacccgagatcgccgagatcctgaccgcctatctcgcgcgcggc
ggcctgcgcaccgtgcacgcggccgacggccgccgcgcactggaactgcaccttcagctc
aagcccgacctcgtgctgctcgacgtgcagatgccgcacgtcgacggctggaaggtgctc
gccgaaatccgtcatcgcggcgacacgcccgtgatcatgctgaccgcgctcgaccaggac
atcgacaagctcaccggcctgcgcatcggcgccgacgactacgtggtgaagccgttcaat
cccgccgaagtcgtcgcgcgcgcacaagccgtgctgcgccgttcgatggccggctcgcgc
caggaagagcagcgcgtgctgcgggtcgcgccgttcgagatcgatctcgaacaccacgaa
gccacgctcgaagtgggcagcgagcggcacacgctcgtgctgacgctcaccgagttcaag
ctgctcgcgcagctcgcgcgcgcgccgcggcgcgtgttcagccgcgccgagctgatggcc
acctgcctgccggaaggcgacgcgctggagcgcacggtggacagccacgtcagcaagctg
cgcaagaagctggacgatctcggcatgcagggcgtaccggtcagcgtgcgcggcgtcggc
tacaagctctggagttga

DBGET integrated database retrieval system