KEGG   Burkholderia lata: Bcep18194_B3167Help
Entry
Bcep18194_B3167   CDS       T00286                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bur  Burkholderia lata
Pathway
bur00072  Synthesis and degradation of ketone bodies
bur00650  Butanoate metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep18194_B3167
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcep18194_B3167
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bcep18194_B3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C Epimerase IF2_N
Motif
Other DBs
NCBI-ProteinID: ABB13277
UniProt: Q38ZT9
Position
2:3573225..3574010
Genome map
AA seq 261 aa AA seqDB search
MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEIVKAGGKAIGV
AMDVTNEEAVNSGIDKVAATFGSVDILVSNAGIQIVNPIENYAFSDWKKMQAIHVDGAFL
TTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVR
SHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGNTVDGVFTTVQDVAQTVLFLS
AFPSAALTGQSFIVSHGWFMQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgaatggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggcaag
gaaatcgcactcgagctcgccaaggcgggcgcggccgttgcgatcgccgacctgaaccag
gacggcgcgaatgccgttgccgacgagatcgtcaaggcgggcggcaaggcgatcggcgtc
gcgatggacgtgacgaacgaggaagccgtgaacagcgggatcgacaaggtggccgcaacg
ttcggctcggtcgacatcctcgtgtcgaacgcaggcatccagatcgtcaacccgatcgag
aactacgcgttctccgactggaagaagatgcaggcgatccacgtcgacggcgcgttcctg
acgaccaaggccgcgctcaagcacatgtacaaggacgatcgcggcggtgtcgtgatctac
atgggttcggtgcactcgcacgaagcgtcgccgctgaagtcggcatacgtgacggccaag
cacggcctgctcggcctggcgcgcgtgctggcaaaggaaggcgcgaagcacaacgtgcgc
tcgcacgtcgtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccggag
caggcgaaggagctcggcatcagcgaagaggaagtggtgaagaaggtgatgctcggcaat
acggtcgacggcgtgttcacgaccgtccaggacgtcgcgcagacggtgctgttcctgtcg
gccttcccgagcgccgcgctcacgggccagtcgttcatcgtcagccacggctggttcatg
cagtaa

DBGET integrated database retrieval system