KEGG   Burkholderia sp. 383: Bcep18194_C6660Help
Entry
Bcep18194_C6660   CDS       T00286                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bur  Burkholderia sp. 383
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bur00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:173064..174380
Genome map
AA seq 438 aa AA seqDB search
MFLPQEFIRQKRNRQALDRDGIAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALT
LAQRDSGDVLDWHALELDGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLSAIPGYNVTPDTDAFRRAVRDVGVAIIGQTARLAPADMRIYAIRDVTATVESV
AMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEQSAELARSIVDVGNGAGMKTTAILT
DMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSAELLVTGGLAHDVADARAKL
LRALDSGAAAERFARMVTALGGPADLIDAPARHLARAKVVVPVPARASGVVQRVDCRALG
LAVVALGGGRTRAADAIDYSVGLTALAEIGQRVEADQPLGYVHARDAAAAAHAVDTIQRS
YVLGEAGDAPPTIYQQIG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaccgcaggaattcattcgccagaagcgcaaccggcaggcactcgatcgcgac
gggatcgccgcgttcgtgcgcggcgtgaccgacggcagcgtgaccgagggccaggtggcc
gcgttcgcgatggccgtgtatttcaacgacctgagcaccgacgagcgcgtcgcgctgacg
ctcgcgcagcgcgactcgggcgacgtgctcgactggcatgcgctggagctcgacgggccg
gtgatcgacaagcactcgaccggcggcgtcggcgatgtcgtgtcgctgatgctcgggccg
atggtggccgcgtgcggcggctacgtgccgatgatctcggggcgcgggctcggccacacc
ggcggcacgctcgacaagttgagcgcgattcccggttacaacgtgacgcccgatacggac
gcgtttcgccgtgcggtgcgcgacgtcggcgtcgcgatcatcggacagaccgcacggctg
gcgccggccgacatgcgcatctatgcgattcgcgacgtgacggcgaccgtcgagtcggtc
gcgatgatcaccgcgtcgatcctgtcgaagaagctcgcggccgggctcgacgggctcgtg
atggacgtcaaggtcggctccggcgcattcatgccgaccgccgagcaatcggcggaactg
gcccgcagcatcgtcgacgtcggtaacggcgccggcatgaagacgaccgcgatcctgacc
gacatgaaccagtcgctcgcgccatgcgcgggcaatgcactcgaagtggcgtgcgcgatc
gactacctgacgggcaagtcgcgtccggcccgcctgcatgacgtcacgatggcgctgtcg
gcggagctgctcgtcaccggcgggctggcgcacgacgtcgcagacgcgcgcgcgaagttg
ctgcgcgcgctcgattcgggtgcggcagcggaacgcttcgcgaggatggtcacggcgctc
ggcggccctgcggacctgatcgacgcacctgctcgtcatctcgcgcgggcgaaggtggtc
gtgccggttccggcgcgcgcgagcggcgtggtgcagcgggtcgattgccgcgcgctcggg
ctggcggtcgtcgcgctcggcggtggccgcacgcgtgcggcggatgcgatcgactacagt
gtcggcctgacggcgctcgcggagatcgggcagcgtgttgaagccgaccagccgctcggt
tacgtgcatgcccgtgacgccgccgccgcggcgcatgcggtggacacgatccagcgcagc
tacgtgctgggtgaggcgggtgacgcgccgccgaccatttatcagcagatcggctga

DBGET integrated database retrieval system