KEGG   Burkholderia lata: Bcep18194_C6660Help
Entry
Bcep18194_C6660   CDS       T00286                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
bur  Burkholderia lata
Pathway
bur00240  Pyrimidine metabolism
bur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bcep18194_C6660
Enzymes [BR:bur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Bcep18194_C6660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABB05710
UniProt: Q39PA6
Position
3:173064..174380
Genome map
AA seq 438 aa AA seqDB search
MFLPQEFIRQKRNRQALDRDGIAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALT
LAQRDSGDVLDWHALELDGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLSAIPGYNVTPDTDAFRRAVRDVGVAIIGQTARLAPADMRIYAIRDVTATVESV
AMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEQSAELARSIVDVGNGAGMKTTAILT
DMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSAELLVTGGLAHDVADARAKL
LRALDSGAAAERFARMVTALGGPADLIDAPARHLARAKVVVPVPARASGVVQRVDCRALG
LAVVALGGGRTRAADAIDYSVGLTALAEIGQRVEADQPLGYVHARDAAAAAHAVDTIQRS
YVLGEAGDAPPTIYQQIG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaccgcaggaattcattcgccagaagcgcaaccggcaggcactcgatcgcgac
gggatcgccgcgttcgtgcgcggcgtgaccgacggcagcgtgaccgagggccaggtggcc
gcgttcgcgatggccgtgtatttcaacgacctgagcaccgacgagcgcgtcgcgctgacg
ctcgcgcagcgcgactcgggcgacgtgctcgactggcatgcgctggagctcgacgggccg
gtgatcgacaagcactcgaccggcggcgtcggcgatgtcgtgtcgctgatgctcgggccg
atggtggccgcgtgcggcggctacgtgccgatgatctcggggcgcgggctcggccacacc
ggcggcacgctcgacaagttgagcgcgattcccggttacaacgtgacgcccgatacggac
gcgtttcgccgtgcggtgcgcgacgtcggcgtcgcgatcatcggacagaccgcacggctg
gcgccggccgacatgcgcatctatgcgattcgcgacgtgacggcgaccgtcgagtcggtc
gcgatgatcaccgcgtcgatcctgtcgaagaagctcgcggccgggctcgacgggctcgtg
atggacgtcaaggtcggctccggcgcattcatgccgaccgccgagcaatcggcggaactg
gcccgcagcatcgtcgacgtcggtaacggcgccggcatgaagacgaccgcgatcctgacc
gacatgaaccagtcgctcgcgccatgcgcgggcaatgcactcgaagtggcgtgcgcgatc
gactacctgacgggcaagtcgcgtccggcccgcctgcatgacgtcacgatggcgctgtcg
gcggagctgctcgtcaccggcgggctggcgcacgacgtcgcagacgcgcgcgcgaagttg
ctgcgcgcgctcgattcgggtgcggcagcggaacgcttcgcgaggatggtcacggcgctc
ggcggccctgcggacctgatcgacgcacctgctcgtcatctcgcgcgggcgaaggtggtc
gtgccggttccggcgcgcgcgagcggcgtggtgcagcgggtcgattgccgcgcgctcggg
ctggcggtcgtcgcgctcggcggtggccgcacgcgtgcggcggatgcgatcgactacagt
gtcggcctgacggcgctcgcggagatcgggcagcgtgttgaagccgaccagccgctcggt
tacgtgcatgcccgtgacgccgccgccgcggcgcatgcggtggacacgatccagcgcagc
tacgtgctgggtgaggcgggtgacgcgccgccgaccatttatcagcagatcggctga

DBGET integrated database retrieval system