KEGG   Burkholderia sp. 383: Bcep18194_C6743Help
Entry
Bcep18194_C6743   CDS       T00286                                 

Definition
acyl-CoA dehydrogenase
Orthology
K00255  
long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
bur  Burkholderia sp. 383
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bur01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bur00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:265415..266260
Genome map
AA seq 281 aa AA seqDB search
MTIDFGPSWMDEDLELYRTSVRRFVESEMLPGDEAARKRGHVCHEIWQRAGEPGFLCTDI
PDRDGGGDGDFRHETVLYEEMARRSLTGMCPSIHSIVAHYFLNHGTETQKHVYHAAHGAR
RDRRRAGDDRAGRRLRPAGIANARRTGRRSLRAQRHEDLHHEWPPGGRPARGREDRSGET
RGRHVDPDRRDRGLPRFPRRASARQDRAEGAGHLRAVFRRRTRADGSRARRCRRAGLLPD
HVGPAVRAADHRRDGGRCDGGRVRRDARLRAQSRSVRAAGG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcgggccctcctggatggacgaggatctcgagctgtaccgcacgtcg
gtgcgccgcttcgtcgaaagcgagatgctgccgggcgacgaagcggccaggaagcgcggc
cacgtctgccatgagatctggcagcgcgcgggcgagccgggttttctttgcaccgacatt
ccggaccgcgatgggggcggcgacggcgattttcggcacgagaccgtgctgtacgaggaa
atggcgcgccgcagcctgaccggcatgtgcccgtcgatccactcgatcgtcgcgcattac
ttcctgaatcacggcacggaaacgcagaagcatgtataccacgccgcgcatggcgcgcgg
cgagatcgtcggcgcgctggcgatgaccgagccgggcgccggctccgacctgcaggcatt
gcgaacgcgcgccgaacgggtcggcgatcactacgtgctcaacggcacgaagaccttcat
cacgaatggcctcctggcgggcgtcctgctcgtggtcgcgaagaccgatccggcgaaacg
cgcgggcggcacgtcgatcctgatcgtcgagaccgaggattgccccggtttccgcgtcgg
gcgtctgctcgacaagatcgggctgaaggtgcaggacacctgcgagctgtttttcgacga
cgtacgcgtgccgacggatcgcgtgctcggcggtgtcgacgggcagggcttctaccagat
catgttggacctgccgtacgagcggctgatcatcggcgtgatggcggccgctgcgatgga
gggcgcgtacgacgcgacgctcgactacgtgcgcaatcgcgaagcgttcgggcggccggt
ggctga

DBGET integrated database retrieval system