KEGG   Burkholderia lata: Bcep18194_C6743Help
Entry
Bcep18194_C6743   CDS       T00286                                 

Definition
(GenBank) Acyl-CoA dehydrogenase-like protein
  KO
K00255  long-chain-acyl-CoA dehydrogenase [EC:1.3.8.8]
Organism
bur  Burkholderia lata
Pathway
bur00071  Fatty acid degradation
bur01100  Metabolic pathways
bur01212  Fatty acid metabolism
Module
bur_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C6743
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.8  long-chain acyl-CoA dehydrogenase
     Bcep18194_C6743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: ABB05792
UniProt: Q39P24
Position
3:265415..266260
Genome map
AA seq 281 aa AA seqDB search
MTIDFGPSWMDEDLELYRTSVRRFVESEMLPGDEAARKRGHVCHEIWQRAGEPGFLCTDI
PDRDGGGDGDFRHETVLYEEMARRSLTGMCPSIHSIVAHYFLNHGTETQKHVYHAAHGAR
RDRRRAGDDRAGRRLRPAGIANARRTGRRSLRAQRHEDLHHEWPPGGRPARGREDRSGET
RGRHVDPDRRDRGLPRFPRRASARQDRAEGAGHLRAVFRRRTRADGSRARRCRRAGLLPD
HVGPAVRAADHRRDGGRCDGGRVRRDARLRAQSRSVRAAGG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcgggccctcctggatggacgaggatctcgagctgtaccgcacgtcg
gtgcgccgcttcgtcgaaagcgagatgctgccgggcgacgaagcggccaggaagcgcggc
cacgtctgccatgagatctggcagcgcgcgggcgagccgggttttctttgcaccgacatt
ccggaccgcgatgggggcggcgacggcgattttcggcacgagaccgtgctgtacgaggaa
atggcgcgccgcagcctgaccggcatgtgcccgtcgatccactcgatcgtcgcgcattac
ttcctgaatcacggcacggaaacgcagaagcatgtataccacgccgcgcatggcgcgcgg
cgagatcgtcggcgcgctggcgatgaccgagccgggcgccggctccgacctgcaggcatt
gcgaacgcgcgccgaacgggtcggcgatcactacgtgctcaacggcacgaagaccttcat
cacgaatggcctcctggcgggcgtcctgctcgtggtcgcgaagaccgatccggcgaaacg
cgcgggcggcacgtcgatcctgatcgtcgagaccgaggattgccccggtttccgcgtcgg
gcgtctgctcgacaagatcgggctgaaggtgcaggacacctgcgagctgtttttcgacga
cgtacgcgtgccgacggatcgcgtgctcggcggtgtcgacgggcagggcttctaccagat
catgttggacctgccgtacgagcggctgatcatcggcgtgatggcggccgctgcgatgga
gggcgcgtacgacgcgacgctcgactacgtgcgcaatcgcgaagcgttcgggcggccggt
ggctga

DBGET integrated database retrieval system