KEGG   Burkholderia lata: Bcep18194_C6773Help
Entry
Bcep18194_C6773   CDS       T00286                                 

Definition
iron-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bur  Burkholderia lata
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcep18194_C6773
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C6773
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C6773
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep18194_C6773
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep18194_C6773
   00626 Naphthalene degradation
    Bcep18194_C6773
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcep18194_C6773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:295964..297130
Genome map
AA seq 388 aa AA seqDB search
MEMSPQSMLFETVPSILQEWGCVRRLGQVMAAWTERRHVLIVTDAGLHNAGVLEPAKASL
AAEGFRVAVFDEVVADPPESVVSRCVEFARGAEADIVIGLGGGSSMDIAKLAAVLTVSRQ
SLAEMYGIGNVKGARLPLVQIPTTAGTGSEVTNISIVSVNETTKMGIVSRQLYADKVILD
AELTVGLPRSHTAATGIDAMVHAIEAYTSKHKKNALSDALAREALRLLVSNLIPACENGH
DRHAREAMLLGATLAGQAFANAPVAAVHALAYPLGGHFHIPHGLSNALMLGPVLRFNAEA
AASHYSELADVVSVGGTGDATARTAAFIAFLEDLMDRSGAPRRLRDVGVTQASLPTLAAD
AMKQQRLLLNNPVVVTESDALRLYEQAY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtccccgcaatcgatgctcttcgaaactgttccgtccattctccaggaatgg
gggtgtgtacgccgcttgggtcaggtgatggcggcctggacggagcgccgtcatgtcctg
atcgtgaccgacgcggggctgcacaacgccggtgtgctggaaccggcgaaagcgtcgttg
gcagccgagggattccgtgtggcggtttttgatgaggtcgtggccgacccgccggagagc
gtggtctcgcgctgcgtcgagttcgcgcgcggtgcggaggcggatatcgtcatcggcctg
ggcggcggctcgtcgatggacattgcaaaactggccgccgtgctcaccgtctcgcggcaa
tcgctcgcggaaatgtacggaatcggcaacgtgaagggcgcacggctgccattggtgcag
atccctacgacggccggtaccggatcggaagtcaccaacatttccatcgtttcggttaac
gaaacaaccaagatgggcatcgtctcacgtcagctgtatgccgacaaagtgatcctggac
gccgaattgacggtcggtctgccgcgcagccataccgccgcgacgggcatcgacgcgatg
gtccacgccatcgaggcctataccagcaagcacaagaagaatgccctctccgacgcgctt
gcgcgtgaggctctgcgattgctggtgagcaacctgatcccggcttgcgaaaacggtcac
gaccggcatgcacgcgaggcaatgctgctgggcgccacgctggcggggcaggccttcgcc
aatgccccggtggccgcggtccatgcgctcgcgtatccgttggggggccatttccatatc
ccgcatggcttgtccaacgcattgatgcttggccccgtgctgcgattcaacgccgaagcg
gccgcttcgcattattcggaactggcagacgtcgtaagcgtgggtggaacgggcgacgcc
acggcgcgcacggcggcgttcatcgcattcctggaagacctgatggaccgatccggcgcg
ccgcgacgtctgcgcgacgtgggtgtcacgcaggcgagcctgccgaccctggcggccgat
gcgatgaagcagcagcgcctgctgttgaacaatccggtcgttgtcacggagtcggacgca
ttgcgcctgtatgaacaggcctattga

DBGET integrated database retrieval system