KEGG   Burkholderia lata: Bcep18194_C6803Help
Entry
Bcep18194_C6803   CDS       T00286                                 

Definition
cytochrome P450 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bur  Burkholderia lata
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C6803
  Amino acid metabolism
   00380 Tryptophan metabolism
    Bcep18194_C6803
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Bcep18194_C6803
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Bcep18194_C6803
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Bcep18194_C6803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(333746..336937)
Genome map
AA seq 1063 aa AA seqDB search
MKSSSLVPQPPLKPVIGHLMEVLGPSPLAKMMDLARTYGPVYWFEVFGQGYYVVSGQTLV
DEVCDETRFQKCVHQSLLELRPAIGDGLFTAFGDEPNWAKAHRVLMQAFGPLSIWSMFDK
MVDIADQMFLHWERFGPETPVDVSDHMTRLTLDTIALCAFDCRFNSFYREDQHPFVDAMV
NTLSEAGKRELRPKLVSKLMVKRSRQFDADIEVMRSLATKMIEDRRKNPHVNEESMDLLD
RMLNGIDPVTGEKLDDENIVFQMITFLIAGHETTSGLLSFATYFLLKNPDILQKARDMVD
EVVGSETPRIEHLARLRYVEQILMETLRIWPTAPGFAVKPLADTTFGGKYAVSPDDIIMI
LTPMLHRDVSVWGEDVEAFRPERFAPENAEQLPPNSWKPFGNGARACIGRPFAMQEAHLV
LIMLLQRFDFSFADPDYELDVAETLTLKPAGFRVNVKPRARGALKVPDTALHARSNAQSP
SVAPVQSIAPGEDLSNLLVLFGGNTGSAESFARRIAGDASRHGFHATCAPLDDFAGKLGG
YPAIVIVTASYEGQPPDNAKSFVPYVEALDEGALDGVHFSVLGCGNKQWARTYQAIPKRV
DEALEKAGATRVHFRGELDSGGDFFGEFDRWYTEMWNRFAISAGKEIPVIQHDDVALKVS
FAGSSREKVLNLGDMAHASIVDNRELVDISVAGSRSKKHIELKLPEAMTYRSGDYLAVLP
RNAKNNVDRVLRRFRVSWDTQVVIEGTSSNPRLPLGQAIGCGELFSSYVELAVPATRSQV
SSLAAATRCPPEKVELERLSADGFECEILGKRTTVMDLLERFGSVDLSLEKFLDMLPALK
ARQYSISSSPLWKADHVTLTVAVVDAPALSGNGRHEGVASSYLARLNTGDSLSVAVRPSN
ARFRPPAEPDLPMILICAGSGIAPFRGFLQERALQKQRGENVGTSLLFFGIDDPDVDFLY
RDELDEWARCGVVEVMPAYSNRPEEGARFVQDKVWLERERISALFSQGATVFVCGDGKNM
APAVRATLGRIYQETTGENDESASAWIDTMEREHGRYVADVFA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctcatccctcgtcccccagccgcccctgaaacccgtcatcggtcatctgatg
gaggtcctcgggccttctccactcgcaaagatgatggatctcgcgcgcacttacgggccg
gtctactggttcgaggtgttcgggcaaggttactacgttgtcagcggacaaacacttgtg
gatgaagtgtgtgacgaaacccgatttcagaagtgcgtacaccagtcgctgctcgaactc
agacccgcgatcggggacgggttatttaccgcattcggtgacgaaccgaactgggccaaa
gcgcatcgcgtgctgatgcaggcgttcggcccgctcagcatctggtcgatgttcgacaag
atggtcgacatcgccgaccagatgtttcttcattgggagcggttcggcccggagacgccg
gtcgatgtgtccgatcacatgactcgactgacgctcgatacgattgccctttgtgcgttt
gattgtcgtttcaacagcttctaccgtgaagaccagcatccgtttgtcgatgccatggtc
aacaccctcagcgaggccggaaagcgcgagttgcgccccaaacttgtttcgaagctgatg
gtcaagcgcagtcgacagttcgacgcggacatcgaagtcatgcgatcgctcgcgaccaaa
atgatcgaagaccggcggaagaacccgcacgtcaacgaagagtcgatggacctgctggac
cgaatgctgaacggcatcgatccggtgacgggagaaaaactggatgacgagaacatcgtc
ttccagatgattacatttctcatcgccggacatgaaacgaccagcgggctcctgtccttt
gccacctatttcctcctcaaaaacccggacatcctgcaaaaagcacgggacatggtcgac
gaggtcgtgggcagcgagacaccacggatcgagcatctcgcacgacttcgctacgtcgaa
caaatcctcatggagacgttgcgaatctggccgacagcgccgggattcgccgtgaagccg
cttgccgacaccacgttcggcgggaaatatgccgtttctcccgacgacatcatcatgatc
ctgacgcccatgctgcatcgggatgtgagcgtctggggcgaggatgtcgaggcgtttcgt
ccggagcgatttgctccggagaatgcggagcaactcccgcccaattcatggaaacccttc
ggcaatggcgcacgtgcctgtatcggccgcccttttgccatgcaggaagcccatctcgtt
ctgatcatgctgcttcagcgattcgatttctctttcgccgatccggactacgagctggac
gtcgccgaaacgctgacgctgaagccggcgggcttccgggtgaacgtgaaaccgcgggcc
cgaggtgcgcttaaagtgcccgatacggcccttcacgcccgctcgaacgctcaaagcccc
agcgtcgctccggttcagtcgatcgcacccggcgaagatttgtcgaatctgctcgtcctc
ttcgggggaaataccggctccgccgaatcctttgcaagacgcattgcaggggacgcgagt
cgtcacggctttcacgccacgtgcgcgccgctcgacgacttcgcaggaaaactcggcgga
tatcctgcaatcgtgatcgtcaccgcttcctacgaaggacagccgccagacaacgcaaaa
tcattcgtcccgtatgtcgaagcactggacgagggtgcgctcgacggcgtccatttttca
gttcttgggtgcggcaacaaacaatgggcacggacataccaggcgattcccaagcgcgtc
gatgaagccctcgagaaggccggtgctacgcgagtgcacttcagaggcgaactcgattcc
ggtggcgacttctttggtgaattcgaccgttggtacaccgaaatgtggaatcgctttgca
atcagcgccgggaaggaaatcccggttattcaacatgacgatgtcgcattgaaagtaagc
ttcgccgggagttcccgtgaaaaggtgcttaacttgggcgacatggcgcatgcgtccatc
gtcgacaatagagagctggtcgacattagcgtggctggcagccgctctaagaagcacatt
gaattgaaacttccggaagcgatgacttatcgatcgggagattatctggccgttctgccc
cgcaacgcgaaaaacaacgtcgatcgcgtcttgcgccggtttcgcgtgagctgggacact
caggtggtgatcgaaggaacgtcaagcaatccgcgccttccgctcggccaggcaataggt
tgcggtgaactgttttcgagctatgtcgaactcgccgttcccgcaactcgatcacaagta
tccagcctggccgctgccacgcgttgcccacccgagaaggtcgagcttgagcgcctgagc
gccgacggtttcgaatgcgagattctgggaaagcggacaaccgtcatggatctgctcgaa
cgcttcggatccgtcgacctgtcgctcgaaaagttccttgatatgctgcccgcgctgaaa
gcacgccagtactcgatctcgtcgtccccgctttggaaagcggaccatgtcacgctgacg
gtggccgtggtcgatgcaccggcgctctccggcaatggtcgtcatgaaggggtggcatcg
tcgtatctcgcgcgactcaacacgggtgacagcttgtccgttgcagtcaggccatcgaat
gcacgctttcggccaccagccgaacccgatcttccgatgattctgatctgcgccggttcc
ggtatcgccccattccgcggctttctgcaagagcgcgcattacagaaacagcggggggag
aacgtcggcacgtcgttgctgttcttcgggatcgatgaccccgacgtcgactttctctat
cgcgacgaactcgacgaatgggcacgatgcggtgtggtcgaagtgatgccggcttattca
aaccgcccggaggaaggtgcccgattcgttcaagacaaagtctggctggaacgcgagaga
atctccgcactgttttcgcaaggtgccaccgtctttgtctgcggggatggaaagaatatg
gcgcccgccgtccgtgccacgcttggtcgcatttatcaggagactactggcgagaacgat
gagagcgccagtgcgtggatcgacacgatggagcgggagcatggcagatatgtcgccgac
gtgtttgcatga

DBGET integrated database retrieval system