KEGG   Burkholderia sp. 383: Bcep18194_C6803Help
Entry
Bcep18194_C6803   CDS       T00286                                 

Definition
cytochrome P450 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bur  Burkholderia sp. 383
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bur00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bur00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bur00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(333746..336937)
Genome map
AA seq 1063 aa AA seqDB search
MKSSSLVPQPPLKPVIGHLMEVLGPSPLAKMMDLARTYGPVYWFEVFGQGYYVVSGQTLV
DEVCDETRFQKCVHQSLLELRPAIGDGLFTAFGDEPNWAKAHRVLMQAFGPLSIWSMFDK
MVDIADQMFLHWERFGPETPVDVSDHMTRLTLDTIALCAFDCRFNSFYREDQHPFVDAMV
NTLSEAGKRELRPKLVSKLMVKRSRQFDADIEVMRSLATKMIEDRRKNPHVNEESMDLLD
RMLNGIDPVTGEKLDDENIVFQMITFLIAGHETTSGLLSFATYFLLKNPDILQKARDMVD
EVVGSETPRIEHLARLRYVEQILMETLRIWPTAPGFAVKPLADTTFGGKYAVSPDDIIMI
LTPMLHRDVSVWGEDVEAFRPERFAPENAEQLPPNSWKPFGNGARACIGRPFAMQEAHLV
LIMLLQRFDFSFADPDYELDVAETLTLKPAGFRVNVKPRARGALKVPDTALHARSNAQSP
SVAPVQSIAPGEDLSNLLVLFGGNTGSAESFARRIAGDASRHGFHATCAPLDDFAGKLGG
YPAIVIVTASYEGQPPDNAKSFVPYVEALDEGALDGVHFSVLGCGNKQWARTYQAIPKRV
DEALEKAGATRVHFRGELDSGGDFFGEFDRWYTEMWNRFAISAGKEIPVIQHDDVALKVS
FAGSSREKVLNLGDMAHASIVDNRELVDISVAGSRSKKHIELKLPEAMTYRSGDYLAVLP
RNAKNNVDRVLRRFRVSWDTQVVIEGTSSNPRLPLGQAIGCGELFSSYVELAVPATRSQV
SSLAAATRCPPEKVELERLSADGFECEILGKRTTVMDLLERFGSVDLSLEKFLDMLPALK
ARQYSISSSPLWKADHVTLTVAVVDAPALSGNGRHEGVASSYLARLNTGDSLSVAVRPSN
ARFRPPAEPDLPMILICAGSGIAPFRGFLQERALQKQRGENVGTSLLFFGIDDPDVDFLY
RDELDEWARCGVVEVMPAYSNRPEEGARFVQDKVWLERERISALFSQGATVFVCGDGKNM
APAVRATLGRIYQETTGENDESASAWIDTMEREHGRYVADVFA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctcatccctcgtcccccagccgcccctgaaacccgtcatcggtcatctgatg
gaggtcctcgggccttctccactcgcaaagatgatggatctcgcgcgcacttacgggccg
gtctactggttcgaggtgttcgggcaaggttactacgttgtcagcggacaaacacttgtg
gatgaagtgtgtgacgaaacccgatttcagaagtgcgtacaccagtcgctgctcgaactc
agacccgcgatcggggacgggttatttaccgcattcggtgacgaaccgaactgggccaaa
gcgcatcgcgtgctgatgcaggcgttcggcccgctcagcatctggtcgatgttcgacaag
atggtcgacatcgccgaccagatgtttcttcattgggagcggttcggcccggagacgccg
gtcgatgtgtccgatcacatgactcgactgacgctcgatacgattgccctttgtgcgttt
gattgtcgtttcaacagcttctaccgtgaagaccagcatccgtttgtcgatgccatggtc
aacaccctcagcgaggccggaaagcgcgagttgcgccccaaacttgtttcgaagctgatg
gtcaagcgcagtcgacagttcgacgcggacatcgaagtcatgcgatcgctcgcgaccaaa
atgatcgaagaccggcggaagaacccgcacgtcaacgaagagtcgatggacctgctggac
cgaatgctgaacggcatcgatccggtgacgggagaaaaactggatgacgagaacatcgtc
ttccagatgattacatttctcatcgccggacatgaaacgaccagcgggctcctgtccttt
gccacctatttcctcctcaaaaacccggacatcctgcaaaaagcacgggacatggtcgac
gaggtcgtgggcagcgagacaccacggatcgagcatctcgcacgacttcgctacgtcgaa
caaatcctcatggagacgttgcgaatctggccgacagcgccgggattcgccgtgaagccg
cttgccgacaccacgttcggcgggaaatatgccgtttctcccgacgacatcatcatgatc
ctgacgcccatgctgcatcgggatgtgagcgtctggggcgaggatgtcgaggcgtttcgt
ccggagcgatttgctccggagaatgcggagcaactcccgcccaattcatggaaacccttc
ggcaatggcgcacgtgcctgtatcggccgcccttttgccatgcaggaagcccatctcgtt
ctgatcatgctgcttcagcgattcgatttctctttcgccgatccggactacgagctggac
gtcgccgaaacgctgacgctgaagccggcgggcttccgggtgaacgtgaaaccgcgggcc
cgaggtgcgcttaaagtgcccgatacggcccttcacgcccgctcgaacgctcaaagcccc
agcgtcgctccggttcagtcgatcgcacccggcgaagatttgtcgaatctgctcgtcctc
ttcgggggaaataccggctccgccgaatcctttgcaagacgcattgcaggggacgcgagt
cgtcacggctttcacgccacgtgcgcgccgctcgacgacttcgcaggaaaactcggcgga
tatcctgcaatcgtgatcgtcaccgcttcctacgaaggacagccgccagacaacgcaaaa
tcattcgtcccgtatgtcgaagcactggacgagggtgcgctcgacggcgtccatttttca
gttcttgggtgcggcaacaaacaatgggcacggacataccaggcgattcccaagcgcgtc
gatgaagccctcgagaaggccggtgctacgcgagtgcacttcagaggcgaactcgattcc
ggtggcgacttctttggtgaattcgaccgttggtacaccgaaatgtggaatcgctttgca
atcagcgccgggaaggaaatcccggttattcaacatgacgatgtcgcattgaaagtaagc
ttcgccgggagttcccgtgaaaaggtgcttaacttgggcgacatggcgcatgcgtccatc
gtcgacaatagagagctggtcgacattagcgtggctggcagccgctctaagaagcacatt
gaattgaaacttccggaagcgatgacttatcgatcgggagattatctggccgttctgccc
cgcaacgcgaaaaacaacgtcgatcgcgtcttgcgccggtttcgcgtgagctgggacact
caggtggtgatcgaaggaacgtcaagcaatccgcgccttccgctcggccaggcaataggt
tgcggtgaactgttttcgagctatgtcgaactcgccgttcccgcaactcgatcacaagta
tccagcctggccgctgccacgcgttgcccacccgagaaggtcgagcttgagcgcctgagc
gccgacggtttcgaatgcgagattctgggaaagcggacaaccgtcatggatctgctcgaa
cgcttcggatccgtcgacctgtcgctcgaaaagttccttgatatgctgcccgcgctgaaa
gcacgccagtactcgatctcgtcgtccccgctttggaaagcggaccatgtcacgctgacg
gtggccgtggtcgatgcaccggcgctctccggcaatggtcgtcatgaaggggtggcatcg
tcgtatctcgcgcgactcaacacgggtgacagcttgtccgttgcagtcaggccatcgaat
gcacgctttcggccaccagccgaacccgatcttccgatgattctgatctgcgccggttcc
ggtatcgccccattccgcggctttctgcaagagcgcgcattacagaaacagcggggggag
aacgtcggcacgtcgttgctgttcttcgggatcgatgaccccgacgtcgactttctctat
cgcgacgaactcgacgaatgggcacgatgcggtgtggtcgaagtgatgccggcttattca
aaccgcccggaggaaggtgcccgattcgttcaagacaaagtctggctggaacgcgagaga
atctccgcactgttttcgcaaggtgccaccgtctttgtctgcggggatggaaagaatatg
gcgcccgccgtccgtgccacgcttggtcgcatttatcaggagactactggcgagaacgat
gagagcgccagtgcgtggatcgacacgatggagcgggagcatggcagatatgtcgccgac
gtgtttgcatga

DBGET integrated database retrieval system