KEGG   Burkholderia lata: Bcep18194_C6864Help
Entry
Bcep18194_C6864   CDS       T00286                                 

Definition
(GenBank) hydroxyneurosporene-O-methyltransferase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:407964..408986
Genome map
AA seq 340 aa AA seqDB search
MENAAKQVLDTLFGRWRSRILYAGTRLGVFDAVTTDTPASSAALAAKLDVDEPLLYRLLR
ALASLGLLDEDTRRGFRATASGALLHADAPSTLRDFVLLQEGPEHYAIWAHLPDMVREGQ
QNGFVREFGAMAFDYAKDHERYRTDFKRAMSSFSTVQSEQVVDALRDVTFAPGTHACDIG
GGQGHMLCSVLRRFQSLTGVVFDLPEVIDGDADDWAQRMGVSARCSKAGGNMFDAVPAAD
VYLLKLILHDWNDDECVAILKRARESARDGARVFVIERVVPAPGVAHFSKLYDIHMMCWG
SGRERTRDEYDALLVAAGWRPAGVRPAPDGQIDVIEAVAA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgcggcaaaacaggtgctggatacgctgttcggacggtggcgcagccggatc
ctgtatgcgggcacgcggctcggcgtgttcgatgcggtgacgaccgacacgccggcgtcg
tcggccgcgctcgcggcgaagctcgacgtcgacgagccgctgctgtaccggctgctgcgc
gcgcttgcctcgctcggcctgctcgacgaggacacgcgccgcggcttccgggccaccgcg
tcgggggcgctgctgcatgcggacgccccgagcacgctgcgcgatttcgtgctgctgcag
gaggggcccgagcactacgcgatctgggcgcacctgcccgacatggtgcgcgaggggcag
cagaacggcttcgttcgcgagttcggcgcgatggcgttcgactatgcgaaggaccacgaa
cgctaccggaccgatttcaagcgtgcgatgtcgagcttttctaccgtgcagtcggagcag
gtcgtcgatgcgctgcgcgacgtcacgttcgcgccgggcacgcatgcgtgcgacatcggc
ggcggccaggggcacatgctctgcagcgtgttgcgacggttccagtcactgaccggcgtc
gtgttcgacctgcccgaagtgatcgatggcgacgccgatgactgggcgcagcggatgggc
gtgagcgcacgttgcagcaaggcgggcggcaacatgttcgacgcggtgccggcggccgac
gtctacctgctgaagctgatcctgcacgactggaacgacgacgagtgcgtggcgattctc
aagcgggcgcgcgaaagcgcgcgggacggcgcgcgtgtgttcgtgatcgaacgggtcgtg
ccggcgccgggcgtcgcgcatttctcgaagctctacgacatccacatgatgtgctggggc
agtggccgcgaacgcacgcgggacgaatacgacgcgctgctcgttgccgccggctggcgg
cccgccggggtccgcccggcacctgacgggcagatcgacgtgatcgaggccgtcgccgcc
tag

DBGET integrated database retrieval system