KEGG   Burkholderia lata: Bcep18194_C6869Help
Entry
Bcep18194_C6869   CDS       T00286                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bur  Burkholderia lata
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcep18194_C6869
Enzymes [BR:bur01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Bcep18194_C6869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(415563..416642)
Genome map
AA seq 359 aa AA seqDB search
MTFNAPTSLAYPARANLQGLFGFDSIRVPRYRLLDGATPIHPLPRLSAYLGGATIHVKRE
DVASVGGGGNKLRKLELLIGEALQSGADTVITVGARQSNHARLTAAAAAHAGMRCEVVLT
RSVPRDDADYIESGNVLLDNLFNARVHDLPASADAMAYAIARADELRAAGHRVYVCPFGG
SSPVGCLAYAACAAEIVQQSQALGTRFDRIIVPNGSGGTHAGLVAGFAALGTGTVEVDAY
TVYAPAADAYRATLDKAQQTANIIHPDTEISPDAVRVDASQLGPGYGIPTDAMRRAVRLL
ASQEGLLLDPVYSGKAFAGLIEGVASGRYASDQSILFVMTGGLPGLFAYRREFQMALDG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactttcaacgcgccaacctctctcgcgtaccctgcgcgagcgaacctccagggattg
ttcggcttcgattcaatccgggtgccgcgttaccgtctgctcgatggcgcaacgccgatt
catcccctgccgcgcctgagtgcctatcttggcggggcgaccattcatgtcaagcgggag
gacgtagcgagcgtgggcggcggcggcaacaaattgcggaaactggagctcctgattggc
gaggcattacagtcaggcgccgacacggtcatcacggttggcgcgaggcaatcgaatcac
gcacggctgaccgcggctgccgcagcccacgcggggatgcgatgcgaggttgtgctcaca
cgctccgtgccgcgcgacgacgccgattacatcgaaagcggcaacgtcctgctcgataac
ctgttcaacgctcgtgtgcacgatttgccggcttcggccgacgcgatggcatacgccatc
gcacgtgcagacgaactgcgtgctgcaggccaccgtgtctatgtctgcccgttcggcgga
tcaagcccggttggctgcctcgcctatgctgcgtgcgcagccgaaatcgtccagcagtct
caggcgctaggcactcgcttcgatcgcatcatcgtgcccaacggaagtggcggcacacat
gccgggctggttgccggcttcgcggcactcgggaccgggacggtcgaagtcgatgcctac
accgtctatgccccagccgcggacgcgtatcgcgccacgctcgacaaggcgcagcagacg
gccaacatcatccatcctgatacggaaatctcgcccgatgccgttcgcgtcgacgcgtcg
caactcggccccggttacggtatccccacggacgccatgcgccgcgccgtccggctgctg
gcctcgcaagaagggctattgctcgatccggtctatagcggaaaggcgtttgcggggctg
atcgaaggcgttgcgtcaggtcgttacgcatccgaccaaagcattctcttcgtcatgacc
gggggattgcctggcttattcgcgtaccggcgcgagtttcagatggctctagatggctga

DBGET integrated database retrieval system