KEGG   Burkholderia lata: Bcep18194_C6883Help
Entry
Bcep18194_C6883   CDS       T00286                                 

Definition
(GenBank) integral membrane protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1772 PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: ABB05929
UniProt: Q39NN7
Position
3:435895..436380
Genome map
AA seq 161 aa AA seqDB search
MIAFVTAALLWGSAIGCGLMAGVYFAFSTFVMTSLGRIAPQAGVAAMNAINVEIVRSPFM
PLFLVTTLMALALVVLALFNREQPGAMVAVAGGALYLFGMFAVTMAVNVPLNDALAAADP
ATAQGAALWTRYVHDWTMWNHVRTVASAAACVFFIAGIAAR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgttcgtgaccgccgcattgctgtggggctcggccatcggctgcgggttgatg
gccggcgtgtatttcgcgttctcgacgttcgtgatgacgtcgctcggacggatcgcgccg
caggccggcgtggccgccatgaacgcgatcaacgtcgagatcgtgcgttcgccgttcatg
ccgctgttcctcgtcacgacgctgatggcgcttgcgctggtcgtgctcgcgctgttcaat
cgcgagcagccgggcgcgatggtggcggtcgcgggtggcgcgctgtacctgttcgggatg
ttcgcggtgacgatggccgtcaacgtgccgctcaacgatgcgctcgccgcggccgatccg
gcgaccgcgcagggtgcggcgctgtggacgcgctatgtgcatgactggacgatgtggaat
cacgtgcgcacggtggcgtcggcagccgcgtgcgtgtttttcatcgcggggattgcggcg
cggtag

DBGET integrated database retrieval system