KEGG   Burkholderia lata: Bcep18194_C6887Help
Entry
Bcep18194_C6887   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2071 DUF5429 ADC
Motif
Other DBs
NCBI-ProteinID: ABB05933
UniProt: Q39NN3
Position
3:complement(439234..440100)
Genome map
AA seq 288 aa AA seqDB search
MPLMLQDNAFVYPSAGPIGRLANRVVASRPLLRTRRALLSRLPFLQLASEVENVVYCTWL
VDVAAVAHLVPRGVTLASRDGRTPFTILTYAHRHFGPRIAGPLRRVFPSPLQSNWRLYVD
ALPGGVPADRTVLFVKNVFDHPLYALGSRLFSDALPSHLAERFTHAVQDGRYRTLLSGGS
GSAPDFHCAAALSDDYSLPEAFAPFFGSWRDAVAYLSLQHAAVAHVADCDRLAHASIDLP
IDIDAVRPLKPVEPVGGGEFLARIGATGEPLCFVVPDVAFRVLSERVL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcatgctccaggacaacgccttcgtttacccttccgccggccccatcggccgc
ctcgccaaccgggtcgtcgcgagccgcccgctgctgcgcacacgtcgcgcgctgctgtcg
cggctgccgttcctgcagctcgcgagcgaggtcgagaacgtcgtgtactgtacgtggctc
gtcgatgttgccgccgtcgcgcacctggtgccacgcggcgtcacgctcgcgagccgcgat
ggccgcacgccgttcacgatcctcacgtacgcgcaccgtcatttcggcccgcgtatcgcg
ggcccgctgcgacgcgtgttcccgtcgccgctgcagagcaactggcggctttatgtcgat
gcgctgccgggcggcgtgccggccgatcgcacggtgctgttcgtgaagaacgtattcgat
cacccgctctatgcgctcggcagccggctcttcagcgatgcgctgccgtcgcatctcgcc
gagcgctttacgcatgccgtacaggacggacgttatcgaacgctgttgtcgggcggtagc
gggagcgcgcccgatttccactgcgcggcagcgctgtcggacgactactcgctacccgag
gcgttcgcgccgttctttggaagctggcgcgacgccgtcgcttacctgtcgctgcagcac
gcggccgtcgcgcatgtcgcggactgcgaccgcctcgcgcatgcgtcgatcgacctgccg
atcgatatcgacgcggttcggccgctgaaaccggtcgagccggtcggtggcggcgagttc
ctcgcgcgcatcggcgcgaccggcgaaccgctgtgcttcgtcgtgccggatgtcgcgttc
agggtgttgtcggagcgggtgttgtag

DBGET integrated database retrieval system