KEGG   Burkholderia lata: Bcep18194_C6888Help
Entry
Bcep18194_C6888   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 HTH_24 MarR_2 HTH_IclR RP-C HTH_40 MarR HTH_36 Rio2_N HemN_C RPA_C DUF2513 Rrf2
Motif
Other DBs
NCBI-ProteinID: ABB05934
UniProt: Q39NN2
Position
3:complement(440177..440479)
Genome map
AA seq 100 aa AA seqDB search
MIDVDRAHKALAHPFRRNVLRWLKAPDTLLANAARLRSQHGVPLSSIVARSGLSQSTVSA
HLAVLCEAGLIVATQVGQWRFVARDDAGIAAFVAQVVSDL
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtcgaccgcgctcacaaggcgctagcgcatccgtttcgacggaatgtactg
cgctggctgaaggcgcccgatacgttgttggcgaacgccgcgcgcctgcgctcgcaacac
ggcgtaccgctttcgtcgatcgtggcacgcagcgggttgtcgcaatcgaccgtgtcggcg
cacctcgccgtgctgtgcgaggccggcttgatcgtcgcgacgcaggtcggccagtggcgc
ttcgtcgcccgcgacgacgcgggcatcgcggcattcgtcgcgcaggtcgtcagcgatctc
tga

DBGET integrated database retrieval system