KEGG   Burkholderia lata: Bcep18194_C6892Help
Entry
Bcep18194_C6892   CDS       T00286                                 

Definition
(GenBank) Sel1-like repeat protein
  KO
K07126  
uncharacterized protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:446341..447432
Genome map
AA seq 363 aa AA seqDB search
MKSYLAVLAILCLTACQAGGQAAAPASVETSVGLQTKEEAVRDNPANPHEKDETGVTASD
VSSSSTSSQKSLAQLVDACHATDPDSCEKAGLGYAAAATDNLLHAADFYADGCDQSNASN
CIRMGLMLQKGDGVQLDWFAAAINFRSACDLDDTECSNLGLAYVFGQGVVRDGRRAVQLF
DKACQAGRMTGCANLGAAYMKGIGVHRDRQRAIALFREACSDGDSLGCFNLGVIYHTGQG
VRRDLKRAATYYQTACDHDDGESCSNLGKLRLGRKIGARDPKTAAQLFYRGCILNDAESC
LYLGLAHQSGDGVRANAYDTRSYLWRAVALDPKSQAARRALARLARIGDERAATPAGRQP
SGE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctatctcgccgtattagcgatcctctgcctgacggcatgtcaggccggaggg
caggccgccgcaccggcgagcgtcgagacatcggtcggactgcaaacgaaagaggaagcg
gtacgcgataacccggcaaacccgcacgaaaaggatgaaaccggcgtgacggccagcgat
gtctcgtcatcgtctacctcttcgcagaagtcgctggcgcagctcgtcgacgcgtgtcac
gcgaccgatccggacagttgcgagaaggccggtttgggctatgccgcggccgcgaccgac
aacctcctgcatgcagcggacttttacgcggacggctgcgaccagtcgaatgcctcgaac
tgcattcgaatggggctcatgctccagaaaggtgacggtgtgcaactggactggttcgcc
gcagcgataaacttcagatcggcctgcgacctcgacgacacggagtgttcgaatctcggc
ctggcttatgtcttcggccagggggtggtgcgggacggcaggcgagccgtgcaactattc
gacaaggcgtgccaggcaggccgtatgacggggtgcgcgaatctcggggcggcctatatg
aaagggatcggcgtgcaccgggatcgccagcgtgcaatcgcgttgttcagggaggcatgc
agcgacggcgattcgctcggctgtttcaacctcggggtgatataccacacggggcaaggc
gtccggcgtgatctgaagcgggcggcgacttactaccagaccgcatgcgatcacgacgac
ggtgaatcgtgcagcaatctcgggaaattgcgactcggccggaaaatcggcgcgcgtgac
ccgaaaaccgcggcacagctgttctatcggggctgcatactgaacgacgccgaaagctgt
ctgtatctcggtctggcccatcagtcgggcgacggcgtccgtgcgaatgcctacgacacg
cggagctatctgtggcgcgcggttgcgctcgatccgaagtcgcaggccgcgcgacgtgcg
cttgcccgtctcgctcgcattggagatgaacgcgcggcgacacccgcaggcaggcaacct
tccggagaatga

DBGET integrated database retrieval system