KEGG   Burkholderia lata: Bcep18194_C6898Help
Entry
Bcep18194_C6898   CDS       T00286                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABB05944
UniProt: Q39NM2
Position
3:451311..452921
Genome map
AA seq 536 aa AA seqDB search
MRDCLTAVRWVWRALRVSGLPAPVALGLRVILLGVRHGWSMYVLAALWKDLAPDEAALTD
DRRQWSWRELVLDVDALATVLDGMGLRRRDRIGLMCRNHGGFVIALLASMRLGADVVLLS
TRFDGRQLAAALDGHDVCTLVVDPEYEAHVKEAGFRGRVLWSEASADREVGDAGPNLPGL
IASTPPVRLGRRRPGALIVLTSGTTGAAKGVRRALSVKQVAGIVYSLVSRLSLRTGARTL
IAVPLFHGYGIAALALGLALRCPVALTRHTDGSRLWAIARRTQATNVVVVPTLLRRMLDA
SLHDPPAAIERIVSGSAPMPTRLIEETSGRWGEVLYNLYGSTEAGLITIADPRDLRDAPD
SVGYAVHGTEVVIRGNAGDTLGPGKIGEVVVTGPLVFDGYDHARVPPVSVHTFATGDKGW
RDDAGRLHLLGRMDDMLIVGGENIYPQQVEDRLMTLRQVVDVAVAGLAAEDGGQRIVAWF
VLRPGHEIGASDIASVLPAYMRPTRWTVVEALPRNAIGKLARGRLAPGTIDTGSGP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgactgcctgacggcggtgcgctgggtatggcgagcgctgcgcgtcagcggcctg
cccgcgccggtcgcgctggggttgcgtgtcatcctgctgggcgtcaggcacggatggtcg
atgtatgtgctcgcggcgctctggaaagatctcgcgcccgacgaagccgcgctgaccgac
gatcggcgccaatggagctggcgggagctcgtgctcgacgtcgacgcgctggcgaccgtg
ctcgacggcatgggcttgcggcgccgcgaccgaatcggattgatgtgccggaaccacggc
ggcttcgtcatcgcgttgctcgcgtcgatgagactgggtgccgacgtcgttctgttgagc
acgcgattcgacgggcgtcagctggcggcggcgctcgacggtcacgatgtctgcacgctc
gtcgtcgatccggaatacgaagcacacgtcaaggaggccggttttcgtggtcgggtgcta
tggagcgaagcgtccgcggatcgtgaggtgggcgatgccggcccgaatctgccgggattg
atcgcctcgacgccccccgtgcggctcggccggcgcaggccgggcgcgttgatcgtgctg
acctccggcacgaccggtgcggcgaaaggcgtgcgccgcgcgctgtccgtgaagcaggtc
gccggaatcgtgtacagcctggtgtcgcggctgtcgttgcgaaccggggcgcgcacgttg
atcgcggtaccgctgtttcacggctacggcatcgcggcgctggcgttgggcctggcgctt
cggtgtccggtggcgctcacgcgtcataccgacggcagccggttgtgggcaatcgccagg
cgcacgcaggcaacgaacgtcgtcgtggtgccgaccttgctgcgccgcatgctggacgca
tcactgcacgatccgcctgccgcgatcgagcgcatcgtgtcgggatccgcgccgatgccc
acgcgcttgatcgaggaaacgtccggccgctggggcgaggtgctctacaacctttacggg
agcacggaagcgggcctgatcacgatcgcggacccgcgggatctgcgtgacgcgcccgac
agcgtcggatacgccgtccacgggacggaggtcgtcattcgagggaatgcaggcgacacg
ctgggcccggggaagatcggcgaagtggtcgtgacggggccgctggtattcgacgggtac
gatcatgcgcgcgtgcccccggtatccgtgcataccttcgcgaccggagacaaagggtgg
cgagacgacgccgggcggctccatttgctggggaggatggacgacatgctgatcgtcggc
ggcgaaaacatctacccgcagcaggtcgaggatcgattgatgacgctgcgtcaggtcgtc
gatgtcgcggtggccgggcttgccgccgaggacggcgggcagcgcatcgttgcgtggttc
gtgctgcggccgggccacgaaatcggggcgtccgatattgcgagtgtgctgcccgcctat
atgcgcccgacgcgctggacggtggttgaagcattgccgcggaacgcgatcggaaaactg
gcgcgcgggcggctcgcgccggggacgatcgacaccggctccgggccgtag

DBGET integrated database retrieval system