KEGG   Burkholderia lata: Bcep18194_C6906Help
Entry
Bcep18194_C6906   CDS       T00286                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bur  Burkholderia lata
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bcep18194_C6906
Enzymes [BR:bur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bcep18194_C6906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(459369..460355)
Genome map
AA seq 328 aa AA seqDB search
MLHVAADHARGAPHTKEETQMETIAVIGSNMVDLVTYVARMPARGETLEAPNFELGCGGK
GANQAVAAARLGARVVMVTKVGDDVFADNTIRNFEREGIDTTHVRKVAGVPSGVAPIFVE
PDSSNSILIVKGANRHLTPADIDAAAPQLAECALIVLQLEIELDTVYHAIAFGARHGIPV
LLNPAPAVADLDFERIRTVEFFVPNETELAIVSGMPVDSRDSAARAAEALVARGLKHVLV
TLGSNGSLLVSRDGVRHVPGVPVDARDTTGAGDAYIGCFARCYAASRDALDAMRYASAYA
AHSVTGLGTQKSYADTATFERFLRDAGV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtcgctgccgaccacgcacgcggcgcaccccataccaaggaagagacgcag
atggagacaatcgccgtcatcggcagcaacatggtcgacctcgtgacctatgtcgcacgc
atgcccgcccggggcgaaacactcgaagcaccgaacttcgagctcggctgcggcggcaag
ggcgcgaaccaggctgtcgcggccgcccgcctcggcgcgcgcgtcgtgatggtcacgaag
gtcggcgacgacgtattcgccgacaacacgatccgcaacttcgagcgcgaaggcatcgat
accacgcacgtgcgcaaggtcgccggcgtgccgagcggcgtcgcgccgatcttcgtcgag
cccgattcgagcaacagcatcctgatcgtcaaaggcgcgaaccgccacctgacgccggcc
gacatcgacgcggccgcgccgcagctcgccgaatgcgcgctgatcgtgctgcagctcgag
atcgaactcgacaccgtctatcacgcgatcgcgttcggcgcgcggcacggcattcccgtg
ctgctgaaccccgcgcccgcggtggccgatctcgatttcgagcggatccgcaccgtcgaa
ttcttcgtgccgaacgaaaccgagctcgcaatcgtgtcgggcatgccggtcgattcgcgc
gacagcgcggcgcgcgccgccgaagcgctggtcgcgcgcgggctcaagcacgtgctcgtc
acgctcggcagcaacggttcgctgctggtatcgcgcgacggtgtgcggcacgtgccgggc
gtaccggtcgacgcacgcgacacgacgggcgccggcgatgcgtatatcggctgcttcgcg
cgctgctatgccgcgtcacgcgatgcgctcgacgcgatgcgttacgcgtccgcgtatgcc
gcgcattcggtcacgggcctcggcacgcagaagtcgtacgccgacaccgcgacgttcgaa
cgcttcctccgcgacgccggcgtctga

DBGET integrated database retrieval system