KEGG   Burkholderia lata: Bcep18194_C6907Help
Entry
Bcep18194_C6907   CDS       T00286                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABB05953
UniProt: Q39NL3
Position
3:complement(460637..461749)
Genome map
AA seq 370 aa AA seqDB search
MEDCLDRRHRLPVVHRDHTSLASRIRNARMTVSLRLSPFTAQGVVQFMTLRQRLRRVNRQ
RETRGIAADFSPAPLGPPAFTTPHDMSRRALALPDAPCLAMTDTDLCRAAAQVSAPHATN
LLRSCSPRCRVCYAARIASPSRSPPMTDLAPDLARTLRASCDACFGTAAVWPLVEHAYRE
PQRHYHTLAHLAELFAHLAPYRTEPLWPAIELAVWAHDFVYATTLPEYSDNEARSAQWLV
EVTNTHCSESWLHAHASHVSVAHDLVLATKSHRLPDTFASDPNLQRAGRIFLDADLAILA
AAPDRLREYDRAIAREWAQDPDAPSAAFRTGRRQALEHLRAQVPLFQSAEFAPLTPRAQR
NLDTLIATYA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaagattgtctcgacagacggcatcggttgcctgtcgtccatcgagatcacacatcg
ctcgcgtcccggatacggaacgcgcggatgacagtatcactacgactatcgccattcacg
gcgcaaggcgtcgtgcagttcatgacgttgcgccaacgacttcgacgtgtcaatcgccag
cgcgagacgcggggcatcgccgccgacttcagccccgcgcccctgggcccgcccgctttc
acgacaccacacgacatgtcgcgtcgggcgctcgcactgcccgacgctccgtgtctcgcg
atgacggacacggacttatgtcgtgccgcagcgcaggtcagcgcgccgcatgcgacgaat
ctcctgcgttcatgcagcccgcgctgccgcgtttgctatgctgcgcgcatcgccagcccg
agccgctcgccaccgatgaccgacctcgcccccgacctcgcccgcacgctgcgcgcctcc
tgcgacgcctgcttcggcacggccgccgtctggccgctcgtcgagcacgcatatcgcgaa
ccgcaacgccactaccacacgctcgcgcacctggccgagctgttcgcgcatctcgcgccg
tatcgcacggaaccgctgtggccagcgatcgaactcgcggtatgggcgcacgacttcgtg
tatgcgacgacgctgccggaatactcggataacgaagcacgcagcgcgcaatggctcgtg
gaagtcacgaacacccactgcagcgaatcctggttgcatgcgcacgcttcgcacgtatcc
gttgcgcacgatctcgtgctcgcgacgaagtcgcatcgtctgcccgatacgttcgcatcc
gatccgaacctgcagcgcgccgggcggatttttctcgacgccgatctcgcgatcctcgcg
gccgcgcccgatcggctgcgcgaatacgaccgcgccatcgcacgcgagtgggcgcaggat
cccgatgcgccgtcggcagcatttcgcacaggccgcaggcaggcgctcgaacacctgcgc
gcacaggtcccgctgtttcaatcggcggaattcgcgccgctcacgccgcgcgcgcagcgc
aatctcgacacgctgatcgccacgtacgcgtaa

DBGET integrated database retrieval system