KEGG   Burkholderia lata: Bcep18194_C6943Help
Entry
Bcep18194_C6943   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:499686..501494
Genome map
AA seq 602 aa AA seqDB search
MPYFGRLTLKHWKIVAAPLIGALAACGGGESADGVAAGQQLAAVPAAAAEKATIEVPGTL
HVDCSLGSNGTGSPATLGSTANPIHDLATLNRIVLTPGMHVRFKRGTTCDGSFAPAPGST
GAAGAPIVVDAYGDPKAPRPVIAAGCTDATADPDQSITEQHKTPSGFSGYYSLCKSDNPT
VNRAAISLYNTQYWEIRSLELTNDATTPGGRLGLYVRLEDYGTGSHYHVDDVYVHHVRGY
LKDVASNTVGSYKTTGGMLFEVTRDNEAVGTKETRTGFDDIAVENSEIYNVDAVALSTRS
AWMCREGGAPCGDYPPYKGNSAYLTNPATQAATDYFPMTHVVFRNNLIHNVGGDGIIVRT
ATAPQVEANHLYDIWMRAPGNSAGAWAINTDDALFRYNEVNGVRLQNNIEAGDGMAFDAD
LGTRNTRVAANFSHDNDGGLMLFCGCGSDGLGHVAQETGAIVENNLSLNDKRRIVSAAGS
ADSVVRDNVVITRTPGLVTPIVENLSYANAFQVTGNRFYNASDSGAIFRTKNAQGSYANI
VWSGNTYFGYAADPEFTGPNYRHGAQPDTVLPFAGQDVDAVASAWSRDSGFDKHKYRAPH
AR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgccatatttcgggagactgaccttgaaacactggaagattgtcgcagcgccgctgatc
ggcgcgctcgcagcatgcggtggcggagaatcggcggacggcgtcgcggccgggcagcag
ttggccgccgtgcccgcggctgcggccgaaaaggcgaccattgaagtgcccggcacgctg
cacgtcgactgctcgctcggctcgaacggaacgggatcgcccgcgacgctgggctccacc
gcgaatccgatccacgatctcgcgacgttgaaccggatcgtgctcacgcccggcatgcac
gtgcgcttcaagcgcggcacgacctgtgacggcagctttgcgcccgcgccgggcagtacc
ggcgcggccggtgcgcccatcgtcgtcgacgcgtacggcgacccgaaggcgccgcgtccc
gtgatcgcggccggctgcaccgatgcgacggccgaccccgaccagtcgatcaccgagcag
cacaagacgccgagcgggttcagcggctattactcgctgtgcaagtcggacaaccccacg
gtgaatcgcgcggccatctctctctacaacacccagtactgggaaatccgctcgctcgag
ctgaccaacgatgcgaccacgcccggcggccgcctcgggctgtatgtgcggctcgaggat
tacggcacgggcagccactatcacgtcgacgacgtgtacgtgcatcacgtgcgcggctat
ctgaaggacgtcgcgagcaatacggtcgggtcgtacaagacgaccggcgggatgctgttc
gaagtgacccgcgacaacgaggccgtcggcacgaaggagacgcgcaccggtttcgacgac
atcgcggtcgagaacagcgagatctacaacgtcgacgcggtggcgctgtcgacgcgatcc
gcgtggatgtgccgggagggcggcgcaccgtgcggcgactatccgccgtacaagggcaat
tcggcgtacctcacgaatccggccacgcaggcagcgacggactatttcccgatgacgcac
gtcgtgttccgcaacaacctgatccacaacgtcggcggcgacggcatcatcgtccgcacg
gccaccgcgccgcaggtcgaggcgaatcacctgtacgacatctggatgcgcgcgccgggc
aacagcgccggcgcatgggcgatcaacacggacgatgcgctgttccgctacaacgaagtc
aacggcgtgcggctgcagaacaatatcgaggccggcgacgggatggcgttcgacgccgat
ctcggcacgcgcaacacgcgcgtagccgcgaacttcagccacgacaacgacggcgggctg
atgctgttctgcggatgcggttccgacggactgggccacgtcgcgcaggaaaccggcgcg
atcgtcgagaacaacctgagcctgaacgacaagcggcgcatcgtgtcggccgcgggctcg
gccgattccgtcgtgcgcgacaacgtcgtgattacgcgcacgccgggcctggtcacgccg
atcgtcgaaaacctcagctacgcgaacgcgttccaggtgacgggcaaccgcttctacaac
gcatcggacagcggcgcgatcttccggacgaagaacgcgcaaggcagttacgcgaacatc
gtgtggagcggcaacacgtacttcggctatgcggcggatccggaattcaccgggccgaac
tatcgtcacggcgcccagcccgatacggtgctgccgttcgcgggccaggacgtggatgcg
gtcgccagcgcgtggtcgcgggacagcgggttcgacaagcacaagtaccgcgcgccgcac
gcacgatga

DBGET integrated database retrieval system