KEGG   Burkholderia lata: Bcep18194_C6954Help
Entry
Bcep18194_C6954   CDS       T00286                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABB06000
UniProt: Q39NG6
Position
3:512360..513784
Genome map
AA seq 474 aa AA seqDB search
MKLYEKLADDIERLIRQGVYRHGDRIPSVRQASQQHRISITTVLHAYLLLESRGLLESRP
QSGYFVNLRRDDSHAPVRELRPSKPIAISSSVDVSRLVLSTLRSIGTDDAVPLGSPYPDP
SLFPFEKLNRYAYAAGRDKSLWGVTDGLPPGHPRLIRQIARRYLENGMSVDPNEIIVTVG
ATEAINLCLQAVAKPGDTIAVESPTFYAMLHAIERMGMKAIEVATHPEYGIDIAALAAIA
KSQPIAACMVMPNFQNPLGFQMPDERKRELVEFATKTGMPLIENGVYNELYFGDAHPSSL
KSYDRSGIVLHCSSFSKSLTAAYRIGWALPGRYRDQVEKLKFLNTLATPSLPQLAIAEFL
ERDGYEHHLRRLRKAYAQQANLMRAMVSRFFPEGTRISSPAGGYVLWVELPAQVDAMRLY
QLALEQGITIGPGYMFSITDSYRNFIRLNYSSPWSPEIEQAVITVGKLASACMR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctatgaaaaactcgcggacgacatcgagcgcctgatccgccagggcgtgtac
cggcacggcgaccggattccgtcggtgcggcaggcgagccagcagcaccggatcagcatc
acgaccgtactgcacgcctatctgctgctggaaagccgcgggctgctcgaaagtcggccg
cagtccggctatttcgtgaacctgcggcgcgacgacagccatgcgccggtgcgcgagctg
cggccgtcgaagccgatcgcgatctcgtcgtcggtcgacgtgagccggctggtgctgtcg
acgctgcgctcgatcggcaccgacgacgcggtgccgctcggctcgccgtatccggacccg
agcctgtttccgttcgagaagctgaaccgctatgcgtatgcggccggtcgcgacaagtcg
ctgtggggcgtgacggacgggctgccgcccggccatccgcggctgatccgccagattgca
cgccgatatctggaaaacgggatgtcggtggacccgaacgagatcatcgtgacggtcggt
gcaacggaggcgatcaacctgtgtttgcaggcggtcgcgaagccgggcgacacgatcgcg
gtggaatcgccgacgttctacgcgatgctgcacgcgatcgaacggatggggatgaaggcg
atcgaggtggcaacgcatccggaatacgggatcgacattgccgcgctcgccgcaattgcg
aagtcgcaaccgatcgccgcgtgcatggtgatgccgaacttccagaacccgctcggcttc
cagatgcccgacgagcgcaagcgcgagctggtcgagttcgcgacgaagaccgggatgccg
ctgatcgagaacggcgtgtacaacgaactgtatttcggcgatgcgcatccgagttcgttg
aagtcgtatgaccgcagcgggatcgtgttgcactgctcgtcgttctcgaagagcctgacg
gccgcgtaccggatcggctgggcgctgccgggccgctatcgtgaccaggtcgagaagctg
aaattcctgaacacgctcgcgacgccgtcgttgccgcagcttgcaatcgcggagtttctc
gaacgcgacggctacgagcatcacctgcggcgcctgcgcaaggcatatgcgcagcaggcg
aacctgatgcgcgcgatggtgtcgcggttcttcccggaaggcacgcgcatctcgagcccg
gccggcgggtacgtgctgtgggtcgagttgcccgcgcaggtcgacgcgatgcggctgtac
cagctcgcgctggagcaggggatcacgatcgggcccggctacatgttctcgatcacggac
agctaccggaacttcatccggctgaactacagcagcccgtggtcgccggagatcgagcag
gccgtgatcacggtcggcaagctggcctcggcgtgcatgcggtga

DBGET integrated database retrieval system