KEGG   Burkholderia lata: Bcep18194_C6971Help
Entry
Bcep18194_C6971   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMI1_KNR4
Motif
Other DBs
NCBI-ProteinID: ABB06017
UniProt: Q39NE9
Position
3:531668..532261
Genome map
AA seq 197 aa AA seqDB search
MTLVDTYLAGLRAALPDTDTAALAATTGATPAQLDALRDAYPQCPASLLELLGKLDGTYW
RDYGGTTVNVLVLGSDVYEYPYYLLSAGQMLEEGAKYRDSIAEIYGDDANDDGELVDSRI
DIALPMNRRLCFSHCMNNGGTSQLYIDFEPAPGGKVGQVVRFLHDPDSYAVIADDFDGYL
RKLIDDGYAFVIDFDEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgtcgacacctatctcgccggcctgcgtgccgcgcttcccgacaccgacacc
gcggcgctcgccgcgacaacgggcgcgacgcccgcgcagctcgacgcgctgcgcgacgcg
tatccgcagtgcccggccagcctgctcgaactgctcggcaagctcgacgggacctactgg
cgcgactacggcggtacgacggtcaacgtgctggtgctcggctccgacgtctacgaatac
ccgtactacctgctgtcggccgggcagatgctcgaggaaggcgcgaagtatcgcgacagc
atcgcggagatctatggcgacgatgcgaacgacgacggcgaactcgtcgactcgcgcatc
gacatcgcactgccgatgaaccggcggctgtgcttctcgcactgcatgaacaacggcggc
acgtcgcagctctacatcgatttcgagccggcgccgggcggcaaggtcgggcaggtcgtg
cgcttcctgcacgatcccgacagctatgcggtgatcgccgacgacttcgacggctacctg
cgcaagctgatcgacgacggttatgcgtttgtcatcgatttcgacgaagaatag

DBGET integrated database retrieval system