KEGG   Burkholderia lata: Bcep18194_C6979Help
Entry
Bcep18194_C6979   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RebB
Motif
Other DBs
NCBI-ProteinID: ABB06025
UniProt: Q39NE1
Position
3:537026..537412
Genome map
AA seq 128 aa AA seqDB search
MMANDTTDPAAPTDPKDPKDPCNCKTCAVNAAITDAVTQTNVKVVGEAPAMATGSLYQAQ
SHSLSVLFENAVQQQSQSAVQLPTSTNVGTMQLYTLGPASAGAAATEIGSNGVLSVLADV
LAIGKALA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaacgacacaaccgacccggcagcaccgacggatccgaaggacccgaaagac
ccctgcaactgcaagacgtgcgcggtgaacgccgcgatcaccgacgcggtcacgcagacc
aacgtcaaggtggtcggcgaagcgccggcgatggcaacgggctcgttgtaccaggcccag
agccattcgctcagcgtgctgttcgagaacgcggtgcagcagcagtcgcagtcggcggtg
cagctgccgacctcgacgaacgtgggcacgatgcagctgtacacgctcgggccggcgagc
gcgggggccgccgcgacggaaatcggctcgaacggcgtgctttccgtgctggccgacgtg
ctcgcgatcggcaaggcgctcgcctga

DBGET integrated database retrieval system