KEGG   Burkholderia lata: Bcep18194_C6981Help
Entry
Bcep18194_C6981   CDS       T00286                                 

Definition
(GenBank) cyclic nucleotide-binding domain (cNMP-BD) protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:complement(537995..538669)
Genome map
AA seq 224 aa AA seqDB search
MPALANAQTLRNIPILTDLPESLIAHVERHVTPWPEHGNRLLFFKGDPGDFVAFVHRGHV
YKTLHEPGGREIILGHSMPGELIGENTLIRAHRRNFTAQLSADCRISLLHRPYFAPLLAN
PEFMGRIHEQLCRHIHQLSDFVESACLYRLDARLARHLLNRMQGNDLEVPLPENQSVLAA
MLNVSRPRLNSSLQKMQRDGLIRLHEHGVTIEKPEQLRTIVDAN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccttgctaacgctcagacgctgcgcaatataccgatactcaccgacctcccg
gaaagcctgatcgcgcatgtcgagcggcatgtcacgccctggcccgaacacggcaatcgc
ctgttgttcttcaagggtgatccgggcgacttcgtcgcattcgtgcaccgcggacacgtc
tacaagacgctgcacgaacccggtggacgcgagatcattctcggccactcgatgccgggc
gaactcatcggcgaaaacacgctgattcgcgcgcaccggcgcaacttcaccgcccagttg
agcgccgactgccgcatttcgctgctgcatcgcccgtacttcgcgccgctgctggccaac
ccggaattcatgggtcgcatccacgagcagctgtgccggcatatccaccagctgagcgac
ttcgtcgagtcggcatgcctgtaccggctcgacgccaggctcgcgcgtcatctgctgaac
cgcatgcaagggaacgatctcgaggtgccgctaccggagaaccagagcgtcctcgcggcg
atgctcaacgtcagccggccgcgactgaacagcagcctgcagaagatgcagcgcgacggc
ctgatccggcttcacgaacacggcgtgacgatcgagaagccggagcagctccggaccatc
gtcgacgccaattga

DBGET integrated database retrieval system