KEGG   Burkholderia lata: Bcep18194_C6983Help
Entry
Bcep18194_C6983   CDS       T00286                                 

Definition
(GenBank) hypothetical protein
Organism
bur  Burkholderia lata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:539675..540055
Genome map
AA seq 126 aa AA seqDB search
MCGVAGLPARPFLQSHAGAGFRGGLVADKVNEQITDAVTQTNVNVVAGSPAQALGTLYQM
FSQAVGISAQNMTQQQAALNQISNAVVSKAVAMILSVEASPKSASGGGAGGAPQVPSAGP
QTGPTH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtcgctggcctgccggcccgtccgttccttcaatcgcatgccggagccggg
ttccgaggaggcctcgtggcagacaaagtcaatgagcagattaccgatgcggtgacgcag
accaacgtcaacgtcgtcgcgggatcgccggcccaggcgctgggcacgctttaccagatg
ttcagccaggccgtcggcatctcggcgcagaacatgacgcagcagcaggccgcgctgaac
cagatttcgaacgccgtcgtgtcgaaggcggtggccatgatcctgtccgtcgaagcatcg
ccgaagagtgcctcgggcggtggggccggcggcgcgccgcaagttccgtcggccgggccg
cagacgggccccacgcattag

DBGET integrated database retrieval system