KEGG   Burkholderia lata: Bcep18194_C6986Help
Entry
Bcep18194_C6986   CDS       T00286                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bur  Burkholderia lata
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcep18194_C6986
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Bcep18194_C6986
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Bcep18194_C6986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:542320..543948
Genome map
AA seq 542 aa AA seqDB search
MNNAPGVRVRPSIESLQAEYLAGNKKPLEDVMRAWKGIKALPPDDPNSFFMIGGFHGEPF
RGAGWGSASYWGGYCNHGNVLFPTWHRAYLLRLEQALQSIPGCEQVMLPFWDETSEESLT
KGIPWALTAPDFELDGETIPNPLASFAFNRAIADNINGDNPNYSKPLPYTTVRYPLSGLV
GTDKDKAATEKHNAKFPNAKENVVILNRNIVDWLTSYIVVKGDVVPTNVKSKFEQCLNAP
NYTVFSNTSSAAQWNENLPADAIPVVPLESPHNDIHLAVGGFDVPHGPNKGDFSPIPGAN
GDMGENDTAGLDPIFYFHHCFIDRVFWLWQKRHGYTQHLDVIAEYPGTNSVDAQGPTPGT
VPNSWLTLESPLDPFKKSENGKERAYTSLDCINIEEQLGYTYGPGSLENLPKYSLAAATV
PAGNSSKVVRVSGLNRAPIAGSFLVSAYVNVDGERQLLGTEAVLSRWSVVSCANCQTHLE
VKAFFPLNHFAESAVQDAQYEVEIHTREGVRLQTQPASPPALQAVAGAPPQPAPKLFRLE
VR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgcacctggagtcagagttcgtccgtcgatcgaatcgttgcaagccgaatat
ctggcaggcaacaaaaagccgctggaagacgtgatgcgcgcgtggaaaggcatcaaggca
ttgccgcccgacgatccgaactcgttcttcatgatcggcggcttccatggcgagccgttc
cgcggcgccggctggggctcggcgtcttactggggcggctattgcaaccacggcaacgtg
ctgttccccacctggcaccgggcctacctgctgcggctggaacaggcgctgcagagcatc
cccggttgcgagcaggtgatgctgccgttctgggacgaaaccagcgaagagtcgctgacg
aaaggcattccgtgggcgctgaccgccccggatttcgagctcgacggcgaaacgattccg
aacccgctggcgtccttcgcgttcaaccgggcgatcgcagacaacatcaacggcgacaat
ccgaactacagcaaaccgctgccctacaccacggtgcgctacccgttgtcggggctcgtg
gggaccgacaaggacaaggccgccaccgagaagcacaacgcgaagtttccgaacgccaag
gagaacgtcgtcatactgaaccgcaacatcgtggactggctcacgtcgtacatcgtcgtg
aagggcgacgtggtgccgaccaacgtgaagagcaagttcgagcagtgcctgaatgcgccg
aactacacggtgttttccaatacgtcgtccgcggcccagtggaacgagaatcttccggcc
gatgcgattcccgtcgtcccgctcgagtcgccgcacaacgatattcaccttgccgtcggc
gggttcgacgtgccgcacggcccgaacaagggcgatttctcgccgattccgggcgccaac
ggcgacatgggcgaaaacgacacggcgggcctcgacccgatcttctatttccaccactgc
ttcatcgatcgtgtgttctggctgtggcagaagcggcatggctacacgcagcacctcgac
gtcatcgccgagtatccgggcaccaactccgtcgatgcgcaggggccgacaccgggcacg
gtgcccaactcgtggctcacgctcgaatcgccgctcgatccgttcaagaagagcgagaac
ggcaaggagcgcgcctatacgtcgctcgactgcatcaacatcgaggaacagctcggctac
acgtacggccccggttcgctggaaaacctgccgaaatactcgctcgcggcagcgaccgtg
ccggccggcaacagcagcaaggtcgtgcgcgtgtccgggttgaatcgtgcgccgattgcc
gggtcgttcctcgtgtccgcgtacgtcaacgtggacggcgaacggcaactgctcggcacg
gaggccgtgctgagccgctggagcgtggtgtcctgcgcgaattgccagacgcacctcgaa
gtcaaggcgttcttcccgctgaatcacttcgccgaaagcgcggtgcaggatgcgcagtac
gaggtcgaaatccatacgcgcgagggcgtacgcctgcagacgcaacccgcgtcaccgccc
gctttgcaagccgtcgccggcgcgccgccgcaacccgcaccgaaactgttccggctcgaa
gtccggtag

DBGET integrated database retrieval system