KEGG   Burkholderia sp. 383: Bcep18194_C6986Help
Entry
Bcep18194_C6986   CDS       T00286                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bur  Burkholderia sp. 383
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bur00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bur00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:542320..543948
Genome map
AA seq 542 aa AA seqDB search
MNNAPGVRVRPSIESLQAEYLAGNKKPLEDVMRAWKGIKALPPDDPNSFFMIGGFHGEPF
RGAGWGSASYWGGYCNHGNVLFPTWHRAYLLRLEQALQSIPGCEQVMLPFWDETSEESLT
KGIPWALTAPDFELDGETIPNPLASFAFNRAIADNINGDNPNYSKPLPYTTVRYPLSGLV
GTDKDKAATEKHNAKFPNAKENVVILNRNIVDWLTSYIVVKGDVVPTNVKSKFEQCLNAP
NYTVFSNTSSAAQWNENLPADAIPVVPLESPHNDIHLAVGGFDVPHGPNKGDFSPIPGAN
GDMGENDTAGLDPIFYFHHCFIDRVFWLWQKRHGYTQHLDVIAEYPGTNSVDAQGPTPGT
VPNSWLTLESPLDPFKKSENGKERAYTSLDCINIEEQLGYTYGPGSLENLPKYSLAAATV
PAGNSSKVVRVSGLNRAPIAGSFLVSAYVNVDGERQLLGTEAVLSRWSVVSCANCQTHLE
VKAFFPLNHFAESAVQDAQYEVEIHTREGVRLQTQPASPPALQAVAGAPPQPAPKLFRLE
VR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgcacctggagtcagagttcgtccgtcgatcgaatcgttgcaagccgaatat
ctggcaggcaacaaaaagccgctggaagacgtgatgcgcgcgtggaaaggcatcaaggca
ttgccgcccgacgatccgaactcgttcttcatgatcggcggcttccatggcgagccgttc
cgcggcgccggctggggctcggcgtcttactggggcggctattgcaaccacggcaacgtg
ctgttccccacctggcaccgggcctacctgctgcggctggaacaggcgctgcagagcatc
cccggttgcgagcaggtgatgctgccgttctgggacgaaaccagcgaagagtcgctgacg
aaaggcattccgtgggcgctgaccgccccggatttcgagctcgacggcgaaacgattccg
aacccgctggcgtccttcgcgttcaaccgggcgatcgcagacaacatcaacggcgacaat
ccgaactacagcaaaccgctgccctacaccacggtgcgctacccgttgtcggggctcgtg
gggaccgacaaggacaaggccgccaccgagaagcacaacgcgaagtttccgaacgccaag
gagaacgtcgtcatactgaaccgcaacatcgtggactggctcacgtcgtacatcgtcgtg
aagggcgacgtggtgccgaccaacgtgaagagcaagttcgagcagtgcctgaatgcgccg
aactacacggtgttttccaatacgtcgtccgcggcccagtggaacgagaatcttccggcc
gatgcgattcccgtcgtcccgctcgagtcgccgcacaacgatattcaccttgccgtcggc
gggttcgacgtgccgcacggcccgaacaagggcgatttctcgccgattccgggcgccaac
ggcgacatgggcgaaaacgacacggcgggcctcgacccgatcttctatttccaccactgc
ttcatcgatcgtgtgttctggctgtggcagaagcggcatggctacacgcagcacctcgac
gtcatcgccgagtatccgggcaccaactccgtcgatgcgcaggggccgacaccgggcacg
gtgcccaactcgtggctcacgctcgaatcgccgctcgatccgttcaagaagagcgagaac
ggcaaggagcgcgcctatacgtcgctcgactgcatcaacatcgaggaacagctcggctac
acgtacggccccggttcgctggaaaacctgccgaaatactcgctcgcggcagcgaccgtg
ccggccggcaacagcagcaaggtcgtgcgcgtgtccgggttgaatcgtgcgccgattgcc
gggtcgttcctcgtgtccgcgtacgtcaacgtggacggcgaacggcaactgctcggcacg
gaggccgtgctgagccgctggagcgtggtgtcctgcgcgaattgccagacgcacctcgaa
gtcaaggcgttcttcccgctgaatcacttcgccgaaagcgcggtgcaggatgcgcagtac
gaggtcgaaatccatacgcgcgagggcgtacgcctgcagacgcaacccgcgtcaccgccc
gctttgcaagccgtcgccggcgcgccgccgcaacccgcaccgaaactgttccggctcgaa
gtccggtag

DBGET integrated database retrieval system