KEGG   Burkholderia lata: Bcep18194_C7032Help
Entry
Bcep18194_C7032   CDS       T00286                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bur  Burkholderia lata
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcep18194_C7032
Enzymes [BR:bur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bcep18194_C7032
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_C7032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(593499..595706)
Genome map
AA seq 735 aa AA seqDB search
MTDTLFERSDIDALLAGRHPDPFACLGPHGQTGQVVVRAVLPGAKSVHALSPEGAELGTL
ACVDRAGCFAGTIPRNGGAPHYLLAIDWPDARQVIDDAYAFGTLLDDAVLARFSAGDPAA
VLDCLGATPARIDDTDGVRFAVWAPNAQRVSVVGDFNGWDGRRHPMRLRRPSGVWELFVP
GIGAGECYKYELRAADGRVLPHKSDPCARATEAPPRTASVVADVAALDAFAWHDEGWMHA
RPRADRYRVPWSIYEVHAESWQRVPEEMNRSATWDELAERLIPYVQGMGFTHVEFMPIAE
YPFGGSWGYQPVAQFAPSARFGPVDGFARFVDRAHAAGIGVLVDWVPAHFPDDPHGLAQF
DGTALYEHADPREGLHPDWHTCVFNVGRTEVGAFLAASALAWARRYHVDGIRVDAVASML
YRDYSRAEGEWVPNVHGGRENLESVAFLRMLNDTLHGAAAPAGVVTVAEESTAWPGVTAP
TGDGGLGFDFKWNMGWMHDTLAYVREDPVHRRYHHDRMTFGLVYAFSERFVLPLSHDEVV
HGKGSLVAKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSEFAQWAEFAHDATPHWDLL
DAPAHRGVQRLVRDLNRTYAAEPALHALDCHAAGFSWLIGDDRDNSVFAFARRDEAGHLV
VAICNFTPVPRASYRVGLPAPGQWRELMNTDAAPYGGTNAGNDGAVWAEAVPAHGEAWSA
LLRLPPLATLWLRPA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacgctgttcgaacgatccgatatcgatgcgctgctcgccggccgccatccc
gatccgttcgcgtgcctcggcccgcatggacagacgggccaggtcgtcgtgcgcgcggtg
ctgcccggcgcgaaaagcgtgcatgcgctgtcgccggaaggcgccgaactcggcacgctc
gcgtgcgtcgatcgcgccggctgcttcgcggggacgatcccgcgcaacggcggcgcccct
cactacctgctcgcgatcgactggcccgacgcgcggcaggtgatcgacgacgcgtatgcg
ttcggcacgctgctcgacgacgcggtgctcgcgcgcttctcggccggcgacccggccgcc
gtgctcgactgtctcggcgcgacgcccgcgcgcatcgacgacaccgacggcgtgcgcttc
gcggtctgggcaccgaatgcgcagcgcgtgtcggtggtcggcgatttcaacggatgggac
ggccgtcggcacccgatgcggctgcgccggccgtcgggcgtgtgggagctgttcgtaccg
ggcatcggcgcaggcgagtgctacaagtacgagctgcgcgcggccgacgggcgcgtgttg
ccgcacaagtccgatccgtgcgcacgggcaaccgaagcgccgccacgcacggcatccgtg
gtcgccgatgtcgcggcgctcgacgcgttcgcgtggcacgacgaaggctggatgcacgcg
cggccgcgcgccgaccgctaccgcgtgccgtggtcgatctacgaggtgcatgcggaatct
tggcagcgcgtgcccgaggagatgaaccgcagcgcgacgtgggacgaactcgccgagcgg
ctgattccgtacgtgcagggaatgggcttcacgcacgtcgagttcatgccgatcgccgag
tatccgttcggcgggtcgtggggctaccagccggtcgcgcagttcgcgccgtccgcgcgc
ttcgggccggtcgacggcttcgcccgcttcgtcgaccgcgcgcatgcggccggcatcggc
gtgctcgtcgactgggtgcccgcgcacttccccgacgatccgcatggcctcgcgcagttc
gacggcaccgcgctgtacgagcacgccgacccgcgcgaagggctgcatcccgactggcac
acctgcgtgttcaacgtcggacgcacggaagtcggcgcgttcctcgccgcgtcggcgctc
gcgtgggcgcgccggtatcacgtcgacggcatccgcgtcgacgcggtcgcatcgatgctg
taccgcgactattcgcgcgcggaaggcgaatgggtgccgaacgtgcacggcggccgcgag
aacctcgagtcggtcgcgttcctgcgcatgctgaacgacacgctgcacggtgcggccgcg
ccggccggcgtcgtcaccgtcgcggaggaatcgaccgcgtggccgggcgtcaccgcaccg
accggcgacggcgggctcggcttcgacttcaagtggaacatgggctggatgcacgacacg
ctcgcgtacgtgcgcgaagacccggtgcatcgccgctatcaccacgaccggatgacgttc
gggctcgtgtacgcgttctccgagcgcttcgtgctgccgctgtcgcacgacgaggtcgtg
cacggcaagggctcgctcgtcgcgaagatgccgggcgacgcgtggcaacggctcgcgacg
ctgcgcgcgtacttcggcttcatgtgggcgcaccccggcaagaagctgctgttcatgggc
agcgaattcgcgcaatgggccgagttcgcgcacgacgcgacaccgcactgggacctgctc
gacgcgcccgcgcatcgcggcgtgcagcggctcgtacgcgacctgaaccgcacgtatgcg
gccgaaccggcgctgcacgcgctcgactgtcacgcggcgggcttctcctggctgatcggc
gacgatcgcgacaacagcgtgttcgcgttcgcgcgccgcgacgaggccgggcacctcgtg
gtcgccatctgcaacttcacgccggtgccacgcgcaagctaccgcgtcggcctgcccgcg
cccgggcagtggcgcgagctgatgaacaccgatgccgcgccgtacggcggcaccaacgcc
ggcaacgacggcgccgtgtgggccgaggccgtgcccgcgcacggcgaagcgtggtcagcg
ctgctgcgcctgccgccgctcgcgacgctgtggctgcgccccgcctga

DBGET integrated database retrieval system