KEGG   Burkholderia lata: Bcep18194_C7173Help
Entry
Bcep18194_C7173   CDS       T00286                                 

Definition
AraC family transcriptional regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
bur  Burkholderia lata
Brite
Enzymes [BR:bur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bcep18194_C7173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:756289..757095
Genome map
AA seq 268 aa AA seqDB search
MHPSISALGDAHILIVDDQPDQLRLLIDILRGTGCRISIASDGLQACQRAQALTPDLILM
DVRMPRMDGFTACRLLAADPLTCAIPVIFLTVAGALHERLEGFEIGCVDYVVKPFEPAEV
LARIRVQIAREKRERPVDMESPFVAGKDDDIIVRAAIRHLARTLNDPPTVEQLARAVGTH
EKRLSRAFRDNLGQTVFEYLRHERLRIAQDLLDSTSLSIASIAKEIGFSTPANFATAFRE
RFGLTPTEWRRQRHAGERTARREPQRDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcatccatcgatctccgcattgggcgacgcccatatcctgatcgtcgacgatcagccc
gaccagcttcgcttgctgatcgacatcctgcgcggcacgggctgccggatcagcattgca
tccgacgggctgcaagcgtgccagcgcgcgcaggcgctcacgcccgacctgatcctgatg
gatgtccgcatgccgcgcatggacggcttcaccgcgtgccggctgcttgccgccgatccg
ctgacgtgtgcgattccggtgatcttcctgaccgtggccggcgccttgcacgaacgcctc
gagggattcgaaatcggctgcgtcgactatgtggtgaagccgttcgagcccgccgaagtg
ctcgcgcggattcgcgtgcagatcgcgcgggagaagcgcgagcggcccgtcgacatggaa
agcccgttcgtggccggcaaggacgacgacatcatcgtgcgcgcggccatccgccacctg
gcacggacgctgaacgatccgcccacggtggagcagctggcccgcgcggtcggcacccac
gaaaagcggctgtcacgcgcgtttcgcgacaatctcggccagacggtgttcgagtacctg
cggcacgagcggctgcggatcgcgcaggatctgctggattcgacgtcgctcagcattgcc
agcatcgcgaaggaaatcggcttttccacgccggcgaatttcgcgaccgccttccgcgaa
cgtttcggcctcacgccgaccgagtggcgacgccagcgtcacgccggtgaacgcaccgcg
cgtcgggaaccgcaacgcgacgcgtag

DBGET integrated database retrieval system