KEGG   Burkholderia lata: Bcep18194_C7246Help
Entry
Bcep18194_C7246   CDS       T00286                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bur  Burkholderia lata
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bcep18194_C7246
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcep18194_C7246
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bcep18194_C7246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(836139..836687)
Genome map
AA seq 182 aa AA seqDB search
MSTIYDIPVNAIDGAQTTLRPYEGKVLLVVNVASKCGLTPQYEGLEALYEGKRAEGLEVL
AFPANNFKGQEPGTDAEIQSFCTGTFGVKFPLFSKISVIGDDKHPLYRSLTQAQPQATGD
GPFRTRLEGYGIQPNPAPEVLWNFEKFLVSRTGEVVARFSPDTTADDPKLVAAIDAELAK
AA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgatttacgatattcctgtcaacgcgatcgacggtgcgcaaacaaccctgcgg
ccctacgagggcaaagtgctgctggtggtgaacgtggcgtccaaatgcgggctgacgccg
caatacgaaggtcttgaagcgctctacgaaggcaagcgcgccgaaggcctcgaagtgctg
gcgtttcccgccaacaacttcaaaggccaggagccgggcaccgatgcggaaatccagtct
ttctgcaccggcaccttcggagtgaagtttccgttgttctcgaaaatctccgtgatcggc
gacgacaagcatccgctctatcgctcgctcacccaggcgcagccgcaggcgaccggtgac
ggcccgttccgtacgcgcctcgaaggctacggtattcaaccgaatccggcgcccgaggtg
ctgtggaacttcgagaagtttctcgtgagccgcacgggcgaagtggtcgcgcgtttctcg
cccgatacgaccgcggacgacccgaagctggtcgccgccatcgacgcggagcttgccaag
gcagcgtaa

DBGET integrated database retrieval system