KEGG   Burkholderia lata: Bcep18194_C7333Help
Entry
Bcep18194_C7333   CDS       T00286                                 

Definition
AMP-dependent synthetase/ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bur  Burkholderia lata
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_C7333
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C7333
   00620 Pyruvate metabolism
    Bcep18194_C7333
   00640 Propanoate metabolism
    Bcep18194_C7333
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_C7333
Enzymes [BR:bur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcep18194_C7333
Lipid biosynthesis proteins [BR:bur01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcep18194_C7333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:932362..934314
Genome map
AA seq 650 aa AA seqDB search
MSHPESGQTWQPGQRELQNAGIVKLMRALDVSSYDELMRVSIAEPERYWDTVMRECAIAW
DVPPTGYVDLSRGAQFPSWFPGGKLNWVNTIYAWARHPATAQQKAVVAEREDGSVSTLTF
AELEQRVQDFAAGLARHGVKQGDRIGLLMENGVEATVSLLAIVHLGALVVPLFSGFGVDA
IVARLSAAEARMVIASTGFSRRTKRVDVQGALRDAWRQLPLLEHVIWKRGEGDTAQDARD
LDWQETAAAAPEQRSAAVSVTPDTPFMVIYTSGTTGKPKGVVHTHGSFPIKIAHDSLIHF
DVQPGDVYCWPADMGWIAGTLVLGCALLRGATLVCYDGAPDYPDWSRMSRVVERHRVTHF
GSAPTLIRGMASHEALALAGDRSTVRLLITAGEGIAPEHFNWFLQRFGDGTAPVINYTGG
TEASGALLASVPIRPIPPSGFNTVSPGVAADVVNADGQSVTGEVGELAIRAPFVGMTHSF
WRDDERYLETYWQTIPGIWVHGDLALRTPDGNYFMMGRSDDTLKVAGKRLGPAEVEEVVL
ELHDVAEAAAIGVADADKGQKLVVFIVPKPGTAVAVAELETLVSGHVDKRLGRPFRPGRV
HVVAQLPKTRSSKIMRRVIRSVYCGQPPGDLSSLDNPAALDEVRAASTVS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccctgaatccggccagacctggcaaccgggccagcgcgagctgcagaacgcc
ggcatcgtgaagctgatgcgcgcgctggacgtgtcgtcgtatgacgagctgatgcgcgtg
tcgatcgccgagcccgaacgctactgggacaccgtgatgcgcgaatgcgcgatcgcgtgg
gacgtgccgccgaccggctatgtcgacctgtcgcgcggcgcgcagtttccgagctggttc
cccggcggcaagctcaactgggtcaacacgatctacgcgtgggcacggcatcccgccacg
gcgcagcaaaaagccgtggtggccgaacgcgaggacggcagcgtcagcacgctgaccttc
gcggagctggagcagcgcgtgcaggatttcgccgcggggctcgcgcgtcacggcgtcaag
cagggcgaccgcatcggcctgctgatggaaaacggcgtcgaggccaccgtctcgctgctg
gccatcgtgcacctcggcgcgctggtcgtgccgctgttcagcggcttcggcgtcgacgcg
atcgtggcccgcctgtccgccgccgaagcgcggatggtgattgcctccaccggcttctcg
cgccgcaccaagcgcgtggacgtgcaaggcgcactgcgcgacgcatggcgccagttgccg
ctgctcgaacacgtgatctggaaacgcggcgaaggcgacaccgcgcaggacgcacgcgac
ctcgactggcaggaaaccgcggccgccgcccccgagcaacgcagcgccgccgtgtcggtc
acgcccgacacgccgttcatggtgatctacacgtcaggcaccacgggcaagcccaagggc
gtcgtgcatacacacggcagcttcccgatcaagatcgcgcacgattcgctgatccacttc
gacgtgcagccgggcgacgtctattgctggccggccgacatgggctggatcgccggcacg
ctggtgctcggctgcgcgctgctgcgcggcgcgacgctggtgtgctacgacggcgcgccc
gactaccccgactggtcgcgcatgtcgcgcgtggtcgaacgtcaccgcgtcacgcacttc
ggctcggcgcccacgctgatccgcgggatggcgagccacgaggcactggcgctcgcgggc
gaccgctccacggtacggctgctgatcaccgccggcgaaggcatcgcgcccgagcatttc
aactggttcctgcaacgcttcggcgacggcacggcgcccgtcatcaactacacgggcggc
accgaggcatcgggcgcgctgctcgcgagcgtgccgatccggccgattccgccgagcggc
ttcaacaccgtgtcgccgggcgtggccgccgacgtcgtgaatgccgatggccagagcgtg
accggcgaagtcggcgagctggcgatccgcgcgccgttcgtcggcatgacgcattcattc
tggcgcgacgacgagcgctacctggaaacctactggcagaccattccgggcatctgggtg
catggcgatctcgcgctgcgtacacccgacggcaactacttcatgatgggccgctccgac
gacacgctgaaggtcgccggcaagcggctcgggccggccgaggtcgaggaagtcgtgctg
gagctgcacgacgtggccgaagcggccgcgatcggcgtggcggatgccgacaagggccag
aaactggtggtcttcatcgtgcccaagcccggcacggctgtcgcggttgccgagctggaa
acgctcgtgtccggtcacgtcgacaagcggctgggccgcccgttccggcccggccgcgtg
cacgtggtcgcgcaactgccgaagacgcgcagctccaagatcatgcggcgcgtgatccgc
agcgtgtattgcgggcagccgccgggcgacctgtcgtcgctggacaatcccgccgcgctc
gacgaagtgcgcgcggcctcgaccgtctcctga

DBGET integrated database retrieval system