KEGG   Burkholderia lata: Bcep18194_C7342Help
Entry
Bcep18194_C7342   CDS       T00286                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bur  Burkholderia lata
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcep18194_C7342
   00053 Ascorbate and aldarate metabolism
    Bcep18194_C7342
   00620 Pyruvate metabolism
    Bcep18194_C7342
  Lipid metabolism
   00071 Fatty acid degradation
    Bcep18194_C7342
   00561 Glycerolipid metabolism
    Bcep18194_C7342
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep18194_C7342
   00310 Lysine degradation
    Bcep18194_C7342
   00330 Arginine and proline metabolism
    Bcep18194_C7342
   00340 Histidine metabolism
    Bcep18194_C7342
   00380 Tryptophan metabolism
    Bcep18194_C7342
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcep18194_C7342
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcep18194_C7342
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcep18194_C7342
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bcep18194_C7342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3:943846..945342
Genome map
AA seq 498 aa AA seqDB search
MLSLVSHLDHLNVRPGRLFIDGQWLDWPDARFDQLNPCTNEVMTSFADAGAQGVELAVAA
ARKAFDEGPWPRMRAQDRKRLLQPIVERLYAAEEEIARLQTLDNGIPYAFSRHSRVSAKS
AADVFDHFLGWIDKINGDTLPIFSGASNMQYMTFRDPVGVVAAVLPYNGPVLTFAMKVAP
ALACGCTVIVKSSELTNLAVARLAQIIADSDLPPGVFNFVTGGVETGSALTSHAGVDKVT
FTGSPAVGEKIMIASAPTMKRLSLELGGKSAALVFPDTRSVQTTAHALMGLCSTFLSGQV
CSTPSRAVVHRSIMDEFLHHAQEQLQKVRFGDPFDAATTSAPMISRRHQARVLDYVESGR
QQGATLLAGGRAPGGEFRNGNWVEPALFANVSNDMTIAQEEIFGPVLSVIPFDTEEEAIR
IANDSAYGLAGCVYTTDVSRAFRVARAVKSGAIGVNGFASIPNAPFGGIKRSGTGREGGW
STIEAFTELKTVNFNLDA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtctcgtttcccatctcgaccacttgaacgtccgccccggacgccttttcatc
gatggccaatggctggactggcccgacgcgcgtttcgaccagctcaacccctgcacgaac
gaagtcatgaccagcttcgccgacgccggcgcgcaaggcgtggagctggccgtggccgcg
gcgcgcaaggcattcgacgaaggtccgtggccgcgcatgcgcgcgcaggaccgcaagcgc
ctgctgcagccgatcgtcgagcgcctgtatgcggccgaggaagaaatcgcgcggctgcaa
acgctcgacaacggcattccgtacgcgttcagccgccattcgcgcgtctccgccaagtcg
gccgccgacgtcttcgatcacttcctcggctggatcgacaaaatcaacggcgacacgctg
ccgatcttctccggtgcgtcgaacatgcagtacatgaccttccgcgacccggtcggcgtg
gtcgcggccgtgctgccgtacaacggccccgtgctgacgttcgcgatgaaggtggcgccg
gcgctggcctgcggctgcaccgtgatcgtcaagtcgtcggagcttaccaacctcgccgtg
gcccggctcgcgcagatcatcgccgacagcgacttgccgcccggcgtgttcaacttcgtg
accggcggcgtcgaaacgggtagcgccctcacctcgcacgccggcgtcgacaaggtgacc
ttcaccggcagcccggccgtcggcgaaaaaatcatgatcgcgagtgcgccgacgatgaaa
cgcctgtcgctggaactgggcggcaagagcgcggcgctcgtctttcccgacacgcgcagc
gtgcagaccaccgcgcacgcgctgatggggctgtgctccacgttcctgtcgggacaggtc
tgctccacgccgtcgcgcgcggtcgtgcatcgctcgatcatggacgagttcctgcaccac
gcgcaggaacagctgcagaaggtgcggttcggcgatccgttcgacgcggccaccacgtcg
gcgccgatgatttcccggcgccaccaggcgcgcgtgctcgactacgtcgaaagcggccgc
cagcaaggcgcgacgctgctggcgggcggccgcgcgccgggtggcgaattccgcaacggc
aactgggtcgagccggccctcttcgccaacgtgagcaacgacatgacgatcgcgcaggag
gaaatcttcggccccgtgctgtcggtgattccgttcgacaccgaggaggaagcgatccgc
atcgccaacgacagcgcgtacgggctggccggctgcgtgtacaccacggacgtgagccgc
gcgttccgcgtcgcgcgtgcggtcaagagcggcgcaatcggcgtcaacggctttgccagc
attccgaatgcgccgttcggcggcatcaagcgctcgggcacgggacgcgaaggcggctgg
tcgacgatcgaagcgtttaccgaactgaaaaccgtcaatttcaatctggatgcctga

DBGET integrated database retrieval system