KEGG   Burkholderia sp. 383: Bcep18194_C7385Help
Entry
Bcep18194_C7385   CDS       T00286                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bur  Burkholderia sp. 383
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bur00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bur00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bur00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bur00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:995580..996464
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIDAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLSLVRSIKPSHVDCFYVRQAEALGLGHAVLCAEK
LVGDQPFAVILADDLLDGPTPVLRQMIDVFDHYHASVIGVEEIAPEASKSYGVIDGKRWE
DNLFKLSGIVEKPEPAKAPSNFGVVGRYVLKPKVFEHLRALRPGAGGELQLTDAIQSLLT
DEQVLAHRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFESYLAMRMSALQAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtgacgaaagccgtatttccggttgccggtctcggcacgcgatttctgcct
gcgaccaaggccagcccgaaagagatgctgcctgtcgtggacaaaccgctcattcaatat
gcggtcgaagaagccatcgacgccggcatcaccgaaatgatcttcgtgaccggccgcagc
aagcgggcgatcgaagaccacttcgacaaatcctatgagatcgaggccgaactcgaagcg
cgcggcaaggaaaaactgctgtcgctcgtgcgcagcatcaaaccgagccacgtcgactgc
ttttacgttcgccaggccgaagcgctggggctcggccatgccgtgctgtgcgcggaaaag
ctcgtcggcgaccagccgttcgcggtcatcctcgcggacgacttgctggacggtcccacg
ccggtgctgcgccagatgatcgacgtattcgatcactatcacgcgtcggtgatcggcgtg
gaagagatcgcgcccgaggcatcgaaatcctatggcgtcatcgacggcaaacgctgggag
gacaacctcttcaagctgtccgggatcgtcgagaaaccggagcccgcgaaagcgccgtcg
aatttcggcgtcgtcggccgctacgtgctgaagccgaaggtgttcgaacatctgcgtgcg
ctgcggccgggcgccggcggcgaactgcagctgacggacgcgatccagtcgctgctgacc
gacgagcaggtgctcgcgcatcgctacgacggcacgcgcttcgattgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgttgcgccacccggaagtggccgcggatttc
gagagctatctggccatgcgcatgtcggcgctgcaggccgcctga

DBGET integrated database retrieval system