KEGG   Burkholderia lata: Bcep18194_C7658Help
Entry
Bcep18194_C7658   CDS       T00286                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase (EC:1.1.1.95)
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_C7658
   01230 Biosynthesis of amino acids
    Bcep18194_C7658
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_C7658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_C7658
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Bcep18194_C7658
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_C7658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1302565..1303503
Genome map
AA seq 312 aa AA seqDB search
MTARPGVLALVPLPDTTRDALRRDYVLHDHPDGMPADFAEAGTIRAVVTNGTCGLDDARM
ARLPALEIVCAFGAGYENVDVAAAARRGIVVAHAPGTNASTVADHAIGMLLALARGYAPL
TGAVRAGRWHASRAARPTLTGAALGVIGMGRIGRLVAARAQGFDMTLGYHARGPHGDAPG
RYYADLVQLAADSDFLVIACHGGPATRHLVDRAVLRALGPHGYVVNVARGSVLDTAALRD
ALDAGDIAGAGLDVIEHEPDVPAALFDHPDVLVTPHVAGRSPAAWLAQRDALLASLAQHF
SRLPVEFAVRAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggcccggggtactcgcgctggtgccgttgcccgacacgacgcgcgatgcg
ctgcggcgcgactacgtgctgcacgatcacccggacgggatgccggccgatttcgcggaa
gccggcacgatccgcgcggtcgtgaccaacggcacctgcgggctcgacgacgcacgcatg
gcgcgcctgcccgcgctcgaaatcgtctgcgcattcggcgccggctacgagaacgtcgac
gtcgcggccgccgcgcggcgcggcatcgtcgtcgcgcacgcgccgggcaccaatgcgtcg
accgtcgccgaccacgcgatcggcatgctgctcgcgctcgcgcgcggctatgcgccgctc
accggcgcggtacgggccggccgctggcatgcgtcgcgcgccgcccggcccacgctgacc
ggtgccgcgctcggcgtgatcggcatgggccgcatcggccggctggtggccgcgcgcgcg
cagggcttcgacatgacgctcggctatcacgcacgcggcccgcacggcgacgcgcccggc
cgctactacgccgacctcgtgcagctcgcggccgacagcgactttctcgtgatcgcgtgc
cacggcggcccggccacccggcatctggtcgaccgcgcggtgctgcgtgcgctcgggccg
cacggctacgtcgtcaacgtcgcgcgcgggtcggtgctcgatacggccgcgctgcgcgat
gcgctcgacgcgggcgacatcgcgggcgccgggctcgacgtcatcgaacacgagcccgac
gtgccggccgcgctgttcgaccatccggacgtgctcgtcacgccgcacgtcgcgggccgc
tcgcccgccgcctggctcgcgcagcgcgacgcgctgctcgcgagcctcgcacagcacttc
tcgcgcctgcccgtcgaattcgcggtgcgcgccgcgtag

DBGET integrated database retrieval system