KEGG   Burkholderia lata: Bcep18194_C7658Help
Entry
Bcep18194_C7658   CDS       T00286                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bur  Burkholderia lata
Pathway
bur00260  Glycine, serine and threonine metabolism
bur00680  Methane metabolism
bur01100  Metabolic pathways
bur01120  Microbial metabolism in diverse environments
bur01130  Biosynthesis of antibiotics
bur01200  Carbon metabolism
bur01230  Biosynthesis of amino acids
Module
bur_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_C7658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_C7658
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Bcep18194_C7658
    1.1.1.399  2-oxoglutarate reductase
     Bcep18194_C7658
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_C7658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-ProteinID: ABB06702
UniProt: Q39LG4
Position
3:1302565..1303503
Genome map
AA seq 312 aa AA seqDB search
MTARPGVLALVPLPDTTRDALRRDYVLHDHPDGMPADFAEAGTIRAVVTNGTCGLDDARM
ARLPALEIVCAFGAGYENVDVAAAARRGIVVAHAPGTNASTVADHAIGMLLALARGYAPL
TGAVRAGRWHASRAARPTLTGAALGVIGMGRIGRLVAARAQGFDMTLGYHARGPHGDAPG
RYYADLVQLAADSDFLVIACHGGPATRHLVDRAVLRALGPHGYVVNVARGSVLDTAALRD
ALDAGDIAGAGLDVIEHEPDVPAALFDHPDVLVTPHVAGRSPAAWLAQRDALLASLAQHF
SRLPVEFAVRAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggcccggggtactcgcgctggtgccgttgcccgacacgacgcgcgatgcg
ctgcggcgcgactacgtgctgcacgatcacccggacgggatgccggccgatttcgcggaa
gccggcacgatccgcgcggtcgtgaccaacggcacctgcgggctcgacgacgcacgcatg
gcgcgcctgcccgcgctcgaaatcgtctgcgcattcggcgccggctacgagaacgtcgac
gtcgcggccgccgcgcggcgcggcatcgtcgtcgcgcacgcgccgggcaccaatgcgtcg
accgtcgccgaccacgcgatcggcatgctgctcgcgctcgcgcgcggctatgcgccgctc
accggcgcggtacgggccggccgctggcatgcgtcgcgcgccgcccggcccacgctgacc
ggtgccgcgctcggcgtgatcggcatgggccgcatcggccggctggtggccgcgcgcgcg
cagggcttcgacatgacgctcggctatcacgcacgcggcccgcacggcgacgcgcccggc
cgctactacgccgacctcgtgcagctcgcggccgacagcgactttctcgtgatcgcgtgc
cacggcggcccggccacccggcatctggtcgaccgcgcggtgctgcgtgcgctcgggccg
cacggctacgtcgtcaacgtcgcgcgcgggtcggtgctcgatacggccgcgctgcgcgat
gcgctcgacgcgggcgacatcgcgggcgccgggctcgacgtcatcgaacacgagcccgac
gtgccggccgcgctgttcgaccatccggacgtgctcgtcacgccgcacgtcgcgggccgc
tcgcccgccgcctggctcgcgcagcgcgacgcgctgctcgcgagcctcgcacagcacttc
tcgcgcctgcccgtcgaattcgcggtgcgcgccgcgtag

DBGET integrated database retrieval system