KEGG   Burkholderia lata: Bcep18194_C7658Help
Entry
Bcep18194_C7658   CDS       T00286                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase (EC:1.1.1.95)
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bur  Burkholderia lata
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:bur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcep18194_C7658
   01230 Biosynthesis of amino acids
    Bcep18194_C7658
  Energy metabolism
   00680 Methane metabolism
    Bcep18194_C7658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcep18194_C7658
Enzymes [BR:bur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Bcep18194_C7658
Exosome [BR:bur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep18194_C7658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1302565..1303503
Genome map
AA seq 312 aa AA seqDB search
MTARPGVLALVPLPDTTRDALRRDYVLHDHPDGMPADFAEAGTIRAVVTNGTCGLDDARM
ARLPALEIVCAFGAGYENVDVAAAARRGIVVAHAPGTNASTVADHAIGMLLALARGYAPL
TGAVRAGRWHASRAARPTLTGAALGVIGMGRIGRLVAARAQGFDMTLGYHARGPHGDAPG
RYYADLVQLAADSDFLVIACHGGPATRHLVDRAVLRALGPHGYVVNVARGSVLDTAALRD
ALDAGDIAGAGLDVIEHEPDVPAALFDHPDVLVTPHVAGRSPAAWLAQRDALLASLAQHF
SRLPVEFAVRAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggcccggggtactcgcgctggtgccgttgcccgacacgacgcgcgatgcg
ctgcggcgcgactacgtgctgcacgatcacccggacgggatgccggccgatttcgcggaa
gccggcacgatccgcgcggtcgtgaccaacggcacctgcgggctcgacgacgcacgcatg
gcgcgcctgcccgcgctcgaaatcgtctgcgcattcggcgccggctacgagaacgtcgac
gtcgcggccgccgcgcggcgcggcatcgtcgtcgcgcacgcgccgggcaccaatgcgtcg
accgtcgccgaccacgcgatcggcatgctgctcgcgctcgcgcgcggctatgcgccgctc
accggcgcggtacgggccggccgctggcatgcgtcgcgcgccgcccggcccacgctgacc
ggtgccgcgctcggcgtgatcggcatgggccgcatcggccggctggtggccgcgcgcgcg
cagggcttcgacatgacgctcggctatcacgcacgcggcccgcacggcgacgcgcccggc
cgctactacgccgacctcgtgcagctcgcggccgacagcgactttctcgtgatcgcgtgc
cacggcggcccggccacccggcatctggtcgaccgcgcggtgctgcgtgcgctcgggccg
cacggctacgtcgtcaacgtcgcgcgcgggtcggtgctcgatacggccgcgctgcgcgat
gcgctcgacgcgggcgacatcgcgggcgccgggctcgacgtcatcgaacacgagcccgac
gtgccggccgcgctgttcgaccatccggacgtgctcgtcacgccgcacgtcgcgggccgc
tcgcccgccgcctggctcgcgcagcgcgacgcgctgctcgcgagcctcgcacagcacttc
tcgcgcctgcccgtcgaattcgcggtgcgcgccgcgtag

DBGET integrated database retrieval system