KEGG   Burkholderia sp. 383: Bcep18194_C7658Help
Entry
Bcep18194_C7658   CDS       T00286                                 

Definition
D-isomer specific 2-hydroxyacid dehydrogenase (EC:1.1.1.95)
Orthology
K00058  
D-3-phosphoglycerate dehydrogenase [EC:1.1.1.95]
Organism
bur  Burkholderia sp. 383
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Class
Metabolism; Overview; Carbon metabolism [PATH:bur01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bur01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:bur00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bur00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1302565..1303503
Genome map
AA seq 312 aa AA seqDB search
MTARPGVLALVPLPDTTRDALRRDYVLHDHPDGMPADFAEAGTIRAVVTNGTCGLDDARM
ARLPALEIVCAFGAGYENVDVAAAARRGIVVAHAPGTNASTVADHAIGMLLALARGYAPL
TGAVRAGRWHASRAARPTLTGAALGVIGMGRIGRLVAARAQGFDMTLGYHARGPHGDAPG
RYYADLVQLAADSDFLVIACHGGPATRHLVDRAVLRALGPHGYVVNVARGSVLDTAALRD
ALDAGDIAGAGLDVIEHEPDVPAALFDHPDVLVTPHVAGRSPAAWLAQRDALLASLAQHF
SRLPVEFAVRAA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcggcccggggtactcgcgctggtgccgttgcccgacacgacgcgcgatgcg
ctgcggcgcgactacgtgctgcacgatcacccggacgggatgccggccgatttcgcggaa
gccggcacgatccgcgcggtcgtgaccaacggcacctgcgggctcgacgacgcacgcatg
gcgcgcctgcccgcgctcgaaatcgtctgcgcattcggcgccggctacgagaacgtcgac
gtcgcggccgccgcgcggcgcggcatcgtcgtcgcgcacgcgccgggcaccaatgcgtcg
accgtcgccgaccacgcgatcggcatgctgctcgcgctcgcgcgcggctatgcgccgctc
accggcgcggtacgggccggccgctggcatgcgtcgcgcgccgcccggcccacgctgacc
ggtgccgcgctcggcgtgatcggcatgggccgcatcggccggctggtggccgcgcgcgcg
cagggcttcgacatgacgctcggctatcacgcacgcggcccgcacggcgacgcgcccggc
cgctactacgccgacctcgtgcagctcgcggccgacagcgactttctcgtgatcgcgtgc
cacggcggcccggccacccggcatctggtcgaccgcgcggtgctgcgtgcgctcgggccg
cacggctacgtcgtcaacgtcgcgcgcgggtcggtgctcgatacggccgcgctgcgcgat
gcgctcgacgcgggcgacatcgcgggcgccgggctcgacgtcatcgaacacgagcccgac
gtgccggccgcgctgttcgaccatccggacgtgctcgtcacgccgcacgtcgcgggccgc
tcgcccgccgcctggctcgcgcagcgcgacgcgctgctcgcgagcctcgcacagcacttc
tcgcgcctgcccgtcgaattcgcggtgcgcgccgcgtag

DBGET integrated database retrieval system