KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_033Help
Entry
BVAF_033          CDS       T01398                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BVAF_033 (holC)
   00240 Pyrimidine metabolism
    BVAF_033 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BVAF_033 (holC)
   03430 Mismatch repair
    BVAF_033 (holC)
   03440 Homologous recombination
    BVAF_033 (holC)
Enzymes [BR:bva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BVAF_033 (holC)
DNA replication proteins [BR:bva03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BVAF_033 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42138..42620)
Genome map
AA seq 160 aa AA seqDB search
MSNIKKGIFYILPSINSNAELSFKENFACHLSKIMWRSGKSILIACENKNQALKINNSLW
NVDNNSFLPNDLLRKNTHYTPITIYWEQCCYHNNLLKDTLINLMKINKDFFFNFNEIIDF
VPSTNILKKLARIRYKTLQNIGFDLKVSNTSNFKINNINK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatataaaaaaaggaatcttttacatactaccatcgattaactccaacgcagaa
ttaagtttcaaagaaaattttgcatgtcatttgtcaaaaatcatgtggagatcaggaaag
agtattttaatagcttgtgaaaataaaaaccaagctttaaaaataaataattctttatgg
aatgttgacaacaattcttttttacctaatgatttattaagaaaaaatacgcattacacc
cctattactatatattgggaacagtgctgttaccataataatctactgaaagatacatta
attaatcttatgaaaataaataaagacttttttttcaattttaatgaaattattgatttt
gttccttcaacaaatattttaaagaaacttgctagaatacgatataaaacattacaaaac
attggatttgatttaaaagtatcaaatacatctaattttaaaataaataatattaataaa
tga

DBGET integrated database retrieval system