KEGG   Candidatus Blochmannia vafer: BVAF_099Help
Entry
BVAF_099          CDS       T01398                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bva  Candidatus Blochmannia vafer
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bva00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112444..113280
Genome map
AA seq 278 aa AA seqDB search
MKLVANERVLDLSYTQIMGILNVTPDSFFDGGLYNTVPKSIDHVDKMISNGATLIDIGGE
STRPGSKRISDEEELERVLPVIQAIVNRFDIFISVNTSSALVIKESAQLGVHLINDVRSL
ADVEAMKAAKYSNLPICLMHMQGSPDTMQKLPSYHNVVHEVFDYFKDQITRCQLAGINKT
RLLLDPGFGFGKSFQHNYQLLSNLKYFHHFNLPLLIGISRKSMLHCNNNTYCVKNRLAGS
IACAVIASIQKVQIIRVHDVKETMEALRIVKIVQEERL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgcaaatgagcgagtattagatctttcgtatactcaaattatgggtatt
ctaaatgttactcctgattctttttttgacggaggattgtataatactgtgcccaaatca
attgatcatgtagataaaatgatttctaatggagctactttaattgatattggaggagag
tctactagaccaggatctaagagaattagtgatgaagaagaattggaacgtgtattaccg
gtgatacaagctattgtaaatcgttttgatatttttatttcggtgaacacttcatctgca
ttagtaattaaagaaagcgctcaattgggagtacatttaattaatgatgttcgatcttta
gccgatgttgaagcaatgaaagctgcaaagtattctaatcttccaatatgtttaatgcat
atgcaaggtagtccagatactatgcaaaaacttcctagttatcataatgttgttcatgag
gtattcgattattttaaggatcaaattacacggtgtcaattagcgggtatcaataaaact
cgtttattacttgatcctggttttgggtttggaaagagttttcaacataattatcaatta
ttatctaatttgaaatattttcatcattttaatttacctttattgatagggatatctaga
aaatctatgttacattgtaataataatacttattgcgtaaaaaacagattggcagggagt
atagcgtgtgctgtaattgcatcaattcagaaagttcaaattattcgggttcatgatgtt
aaagagacaatggaagcattacggatagttaaaattgtgcaagaagaaagattgtag

DBGET integrated database retrieval system