KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_099Help
Entry
BVAF_099          CDS       T01398                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVAF_099 (folP)
Enzymes [BR:bva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BVAF_099 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112444..113280
Genome map
AA seq 278 aa AA seqDB search
MKLVANERVLDLSYTQIMGILNVTPDSFFDGGLYNTVPKSIDHVDKMISNGATLIDIGGE
STRPGSKRISDEEELERVLPVIQAIVNRFDIFISVNTSSALVIKESAQLGVHLINDVRSL
ADVEAMKAAKYSNLPICLMHMQGSPDTMQKLPSYHNVVHEVFDYFKDQITRCQLAGINKT
RLLLDPGFGFGKSFQHNYQLLSNLKYFHHFNLPLLIGISRKSMLHCNNNTYCVKNRLAGS
IACAVIASIQKVQIIRVHDVKETMEALRIVKIVQEERL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagttgcaaatgagcgagtattagatctttcgtatactcaaattatgggtatt
ctaaatgttactcctgattctttttttgacggaggattgtataatactgtgcccaaatca
attgatcatgtagataaaatgatttctaatggagctactttaattgatattggaggagag
tctactagaccaggatctaagagaattagtgatgaagaagaattggaacgtgtattaccg
gtgatacaagctattgtaaatcgttttgatatttttatttcggtgaacacttcatctgca
ttagtaattaaagaaagcgctcaattgggagtacatttaattaatgatgttcgatcttta
gccgatgttgaagcaatgaaagctgcaaagtattctaatcttccaatatgtttaatgcat
atgcaaggtagtccagatactatgcaaaaacttcctagttatcataatgttgttcatgag
gtattcgattattttaaggatcaaattacacggtgtcaattagcgggtatcaataaaact
cgtttattacttgatcctggttttgggtttggaaagagttttcaacataattatcaatta
ttatctaatttgaaatattttcatcattttaatttacctttattgatagggatatctaga
aaatctatgttacattgtaataataatacttattgcgtaaaaaacagattggcagggagt
atagcgtgtgctgtaattgcatcaattcagaaagttcaaattattcgggttcatgatgtt
aaagagacaatggaagcattacggatagttaaaattgtgcaagaagaaagattgtag

DBGET integrated database retrieval system