KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_114Help
Entry
BVAF_114          CDS       T01398                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVAF_114 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVAF_114 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BVAF_114 (thrC)
Enzymes [BR:bva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BVAF_114 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131197..132522
Genome map
AA seq 441 aa AA seqDB search
MKLLYNIKHSKEKVSFSEALIRGLGKNQGLFFPINLPKFSSSEIDTLLKMNFIERSAYIL
SKYIGAELLYENILTCVKNAFTFPVPLVFIKKNIAILELFHGPTLAFKDFGSRLMASMLM
NQVKEGYKLIKTKPLVILTATSGDTGAAVAHAFYGLKNIHVFILYPKDKISILQEKSFCT
LGGNITTISVDGDFDICQSLVKQSFEDDFLKKKLHLNSANSINISRLLAQVCYYFEALSQ
ISERIRATNKLVISVPSGNFGNLTAGLLAQSSGLPVQCFIIATNLNDTVPRFLQSGIWNP
LPTLSTLSNAMDVSCPSNWSRIEELFRREKRSFDELKYGCVNDELTKDTINKLSKLGYIA
DPHTAVAYQVLCDQLNCGEFGICLGTAHPAKFKKLIEFVLDKKVNVLLPDVLKNQIKLPI
LSYRISGCFSKLRDLICSIVL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattatataatattaaacatagtaaagaaaaagttagtttttctgaggccctt
atacgaggtttaggaaaaaatcagggattgtttttccccattaatttgcctaaattttcg
agttctgaaattgatacgttattgaaaatgaatttcatagaacgaagtgcatatatacta
tcaaaatatataggggctgagctgttatatgaaaatattttaacttgcgttaaaaatgca
tttacttttcccgttccattagtttttatcaaaaaaaatattgcgattttagaattgttt
catggtccgactttagcttttaaagattttggtagtcgattaatggcaagcatgttgatg
aatcaagttaaagaaggttataaattaattaaaacaaaacctttggtgattcttacggct
acttcaggagatacgggagctgcagtagctcatgccttttatggattgaaaaatatacat
gtttttattttgtatcctaaagataaaattagtatattacaagaaaaatcattttgtaca
ttaggaggtaatataactactatttcggttgatggagattttgatatttgtcaaagttta
gtgaaacaatcttttgaagatgattttttaaaaaagaaattacatttaaattctgcgaat
tccattaatattagcagattattagctcaagtttgttattattttgaagcattatctcaa
atttccgaacgaatacgtgctactaataaattagtaatatcagttcctagtggaaatttt
ggtaatttaacagcaggacttttagctcagtcttctggattaccggttcaatgttttatt
attgctactaatttaaatgatacggttcctagatttttacagtctggtatatggaaccct
ttgcctactctttcaacattatctaatgcaatggatgttagttgtcctagtaattggagt
agaatagaggagttatttagaagggagaagagatcttttgacgaattaaaatatgggtgt
gttaatgatgagttgactaaagacacaataaataaactttcaaagttaggatatatcgct
gatccgcatactgcagtagcatatcaagtattatgtgaccaattgaattgtggtgaattt
ggaatatgtcttggtactgcacatcccgctaaatttaaaaaattaatagaatttgtgtta
gataaaaaagtaaatgtattgttacctgatgttttaaaaaatcaaataaaattacctatt
ttatcatatagaatatcggggtgtttttctaaattacgtgatttaatttgttctattgta
ttataa

DBGET integrated database retrieval system