KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_255Help
Entry
BVAF_255          CDS       T01398                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BVAF_255 (speB)
Enzymes [BR:bva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BVAF_255 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277516..278430
Genome map
AA seq 304 aa AA seqDB search
MNNFSCNNDHSLFSNAFGFLRLPLEFDPYTQCSDWVITGVPFDMATSGRPGSRFGPTAIR
QASINLVWEQCRWPWNFNIREKLKIIDCGDLVYKIGSIQNFTDNLQIHIEHLLNSRKKVF
LLGGDHYITLPALRAYSKIFGKIAIIHFDAHTDCYSNCSQYDHGAVMLYALNEGLINPNL
SIQIGIRTEYDTKFGFTILDSEFVNSVDTSIIVNKIISVIQNAPVYLTFDIDCLDPSIAP
GTGTPVIGGLTSSCVLKLIRSLKKINIIGMDIVEVSPEYDCSQITALTAATLGLEMLYTQ
AVIC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattttagttgtaataatgatcattctttattttcaaatgcgtttggattttta
agattacctttagaattcgatccatatacccaatgtagtgattgggtaattactggagta
ccttttgatatggctacttctggaaggccgggaagtagatttggtccaactgccattagg
caagcgtctataaatctagtttgggaacagtgtcggtggccttggaattttaatatacga
gaaaaattaaaaattattgattgtggtgatttagtatataaaataggtagtattcaaaat
tttacggataatttacaaatacatattgaacatttattaaattctagaaagaaggttttt
ttattaggaggggaccattatatcacattacctgctttacgtgcttactcaaaaattttt
ggaaaaatagctattattcattttgatgctcatacagattgttatagtaattgtagtcag
tatgatcacggagctgttatgttatatgcattaaatgaaggattgattaatcctaattta
tcaattcaaattggaattcggactgaatatgatacaaaatttggttttacaatattagat
tcagaatttgttaattcagtggatactagtattatagttaataaaataatatcggttatt
caaaatgcgccagtatatttgacttttgatatagattgtttagatccatcaatagcacct
ggaactggcactcctgtaattggaggattaacttcatcgtgtgttttaaaattaatacgc
agtttaaaaaaaataaatattattgggatggatatagtagaagtatcccctgaatatgat
tgctctcaaattactgcattaactgcggctacgttaggtttagaaatgttatatacacag
gctgttatttgctga

DBGET integrated database retrieval system