KEGG   Candidatus Blochmannia vafer: BVAF_255Help
Entry
BVAF_255          CDS       T01398                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bva  Candidatus Blochmannia vafer
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bva00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277516..278430
Genome map
AA seq 304 aa AA seqDB search
MNNFSCNNDHSLFSNAFGFLRLPLEFDPYTQCSDWVITGVPFDMATSGRPGSRFGPTAIR
QASINLVWEQCRWPWNFNIREKLKIIDCGDLVYKIGSIQNFTDNLQIHIEHLLNSRKKVF
LLGGDHYITLPALRAYSKIFGKIAIIHFDAHTDCYSNCSQYDHGAVMLYALNEGLINPNL
SIQIGIRTEYDTKFGFTILDSEFVNSVDTSIIVNKIISVIQNAPVYLTFDIDCLDPSIAP
GTGTPVIGGLTSSCVLKLIRSLKKINIIGMDIVEVSPEYDCSQITALTAATLGLEMLYTQ
AVIC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattttagttgtaataatgatcattctttattttcaaatgcgtttggattttta
agattacctttagaattcgatccatatacccaatgtagtgattgggtaattactggagta
ccttttgatatggctacttctggaaggccgggaagtagatttggtccaactgccattagg
caagcgtctataaatctagtttgggaacagtgtcggtggccttggaattttaatatacga
gaaaaattaaaaattattgattgtggtgatttagtatataaaataggtagtattcaaaat
tttacggataatttacaaatacatattgaacatttattaaattctagaaagaaggttttt
ttattaggaggggaccattatatcacattacctgctttacgtgcttactcaaaaattttt
ggaaaaatagctattattcattttgatgctcatacagattgttatagtaattgtagtcag
tatgatcacggagctgttatgttatatgcattaaatgaaggattgattaatcctaattta
tcaattcaaattggaattcggactgaatatgatacaaaatttggttttacaatattagat
tcagaatttgttaattcagtggatactagtattatagttaataaaataatatcggttatt
caaaatgcgccagtatatttgacttttgatatagattgtttagatccatcaatagcacct
ggaactggcactcctgtaattggaggattaacttcatcgtgtgttttaaaattaatacgc
agtttaaaaaaaataaatattattgggatggatatagtagaagtatcccctgaatatgat
tgctctcaaattactgcattaactgcggctacgttaggtttagaaatgttatatacacag
gctgttatttgctga

DBGET integrated database retrieval system