KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_334Help
Entry
BVAF_334          CDS       T01398                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVAF_334 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVAF_334 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BVAF_334 (sucB)
Enzymes [BR:bva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BVAF_334 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
377906..379225
Genome map
AA seq 439 aa AA seqDB search
MIDSSNSLEILVPNLPESVEDATVAVWHKKEGDKIQQDEILLEIETDKIMLEIPASQNGT
LEMILEKEGSIVRAGQILARLKLNKNIVAMKESKLNPLISNKDYNNQNIALNFNYTSSDQ
KCAQIKQENNSTTFLLKNLSPSIKKLITEYNLNIKEIKGTGIKGRITRQDIETYIKTKLA
QSNNITDPDANININIQDNNISDVSGNRKDTRISMNRLRKKIAERLLYVTNSTAMLTTFN
EVNMQSIISLRNKYNKLFIERHGTKLGFMSFFIKSVLEGLRRFPEINACIDGDDIVYHTY
FDISIAVSTERGLVTPVLRNVNKLSISNIEKQIKFLSEKSRKGKLTLEELTGGNFTITNG
GIFGSLMSTPIINPPQSAILGMHTITERPMAINGQVIILPMMYLALSYDHRLIDGKDSVS
FLKTIKELIEDPTRLLLDI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgattgatagtagtaatagtttagaaattttagtgcctaatttacctgaatctgttgaa
gatgctactgttgctgtatggcataaaaaagagggagataaaattcaacaagatgaaatc
ttacttgaaattgaaacagataaaattatgttagaaattccagcgtctcaaaatggaaca
ttagaaatgatattggaaaaggaagggtctattgttagagctgggcaaatcttagctcgt
ttaaaattgaataaaaatatagttgctatgaaagaatctaaattaaatccactcatttct
aataaagactataataaccaaaatatagctctgaattttaattatacttcttctgatcaa
aaatgtgcccaaattaaacaagagaataatagcactacttttttactaaaaaacttaagc
ccttctattaaaaaattaattactgaatataatctcaatataaaagaaataaaaggaaca
ggcataaaaggacgtatcactaggcaagatatagaaacatacataaagacaaaattagca
caaagcaacaatattaccgatcctgatgccaatataaatattaatattcaagacaataat
attagtgatgtttctggtaatagaaaagatactcgaatttcgatgaatcgtttacgaaaa
aagattgcagaacgtttattatatgtcactaattctacggctatgctcactacatttaat
gaagtaaacatgcaatctattatatctttacgtaataaatataataaattattcatagaa
cgacatggtactaaattaggatttatgtcattttttataaaatcagtattagaaggctta
agacgttttcctgaaattaacgcttgtattgatggggatgatatagtatatcatacttat
tttgatataagtattgcagtttctacagaacgtggattggttactccagtattaagaaat
gtaaataaattaagtatctcgaatattgaaaagcaaattaaatttttatctgaaaaaagt
cgaaaaggaaaattaacgttggaagaattaactggaggaaatttcactattaccaatgga
gggatttttggctctttaatgtctacgcctatcattaatcctccccaaagtgctattctt
ggaatgcataccattacagaacgaccaatggctataaatgggcaagtaataattttacct
atgatgtacttagcattatcatacgatcatagattaatagacggtaaagattcagtaagt
tttttaaaaacgataaaagaattaatagaagatccaactcgattattattagatatttaa

DBGET integrated database retrieval system