KEGG   Candidatus Blochmannia vafer: BVAF_335Help
Entry
BVAF_335          CDS       T01398                                 

Gene name
sucC
Definition
succinyl-CoA ligase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bva  Candidatus Blochmannia vafer
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bva01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bva00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bva00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:bva00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379360..380547
Genome map
AA seq 395 aa AA seqDB search
MTNLYEYQAKKLFRKFKIPILKNWIFSDISEIKHCTSSVIMDGPPWIVKCQIHSGGRGKA
GGVKVANSLEDIYSFATHWLGNRLITDQTSKKGDVVNYILVEPAIKFINEFYFSLFIDRD
SSQILCIVSVKGGIDIENTINKSPDLIFKISIDPMVGAYPYQGRILADKLNLKGIEINKF
VQIYIDIVRMFLENDLTLVEINPFIIDNNHNLLCLDAKVSVDSNSFFRQPNLLSLCLNKH
STNNLNNKLVPLSQDLSINYVSLHGNIGCMVNGAGLAMATMDLIKSLGGEPANFLDIGGD
TDMDSLMSAFTMILKKTSVKAVFVNIFGGIVCCDLVADGIIAVLTKNINNHVPVVIRLEG
NNAILGHKKLINSKLNIFVVNNLLDAVHHTIELVK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctatacgaatatcaagcaaaaaaattatttaggaaatttaaaatacctatt
ttgaaaaattggattttttctgatatctcagaaattaaacattgcacatcatctgtgatt
atggatggacctccatggatagtaaaatgccaaatacattcaggaggacgaggaaaagct
ggaggagttaaagttgcaaattcattagaagatatatattcttttgctacccattggctt
ggcaatcgactaattactgaccaaacatctaaaaaaggagatgttgtaaattatatctta
gtagaaccagcaatcaaatttattaatgaattttatttcagtctattcattgatagagat
tcatctcaaattttatgtatagtttctgtgaaaggagggattgatattgaaaatacaata
aataaatcacctgatttaatttttaagatctcaatagatcccatggttggagcatatcca
tatcaaggtcgtatattagcagataaattaaatttaaaagggatagaaattaataaattt
gttcaaatttatattgatattgttcgaatgtttctagaaaatgatttaactttagtagaa
attaatccatttattattgataataaccataacttactttgtttagatgctaaagttagt
gtcgatagtaattcgttttttagacaacctaatttgttaagtttatgtttaaataaacac
tcaacaaacaatttaaataataaattagttcctctttctcaagatctttcaattaattat
gtttctttacatggaaacataggatgtatggtaaatggagctggtttagcaatggctact
atggatttaataaaatcattaggtggggaaccagctaattttttagatataggtggtgat
acagacatggattctctcatgtctgcatttaccatgattttaaaaaaaacatcggtaaaa
gcagtatttgttaatatttttggtggtattgtgtgttgtgatttagttgcggatggaatt
attgctgttttaactaaaaatatcaataatcatgttcctgttgtgatacgattagaaggt
aataatgctattttaggtcataaaaaattaataaatagtaaattaaatatatttgttgtt
aataatttattagatgcagtgcatcacactatagagttagtaaaataa

DBGET integrated database retrieval system