KEGG   Candidatus Blochmannia vafer: BVAF_344Help
Entry
BVAF_344          CDS       T01398                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bva  Candidatus Blochmannia vafer
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:bva01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bva01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bva00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:bva00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bva00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388397..389104
Genome map
AA seq 235 aa AA seqDB search
MNINKIQVVFVRHGESEWNKNNRFTGWVDIDLSNRGHLEAKQAGQLLKKNNFIFTYGYTS
VLKRAIHTLWIILDQLNQAWLPIKKSWKLNERHYGALQGLNKDEAIKKYGYETIQKWRRN
FKDIPPGRVKNKNLITEIDDIHYNIMGIHNLPNGESLELTANRVIPYWKNVIIPDINNNN
HTIIIVTHGNSIRAMIKFLNCLSETEISKVEVPTGTPLIYEFNRDFQPIKHYYLS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaataaaattcaagtagtatttgtcagacatggagaaagtgaatggaataaa
aataatcgatttactggatgggttgatattgatttatcaaacagaggtcatcttgaagcg
aaacaagctggtcaattacttaaaaagaataattttatctttacttacggatatacttct
gttttaaaaagagcgatacacactttatggataatcttagatcaactaaatcaagcatgg
ctaccaataaaaaaatcttggaaattaaatgaacgtcattatggagctttacaaggatta
aataaagatgaagctataaaaaaatacggttatgaaacaattcaaaaatggcgccgtaat
tttaaagatatccctccaggtagggtaaaaaataaaaatctaattacagaaatagatgac
attcattacaacattatgggaattcataatctccctaatggagaaagtttggagttaact
gcaaatagagttattccatattggaaaaacgttattattcctgacatcaataataataac
catacgattattatcgtcactcatggaaattcaataagagcaatgataaaatttttaaac
tgtttaagtgaaactgaaatttctaaagttgaagttcctaccgggaccccattaatatat
gaatttaatcgtgattttcaacctataaaacattattatttatcttga

DBGET integrated database retrieval system