KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_344Help
Entry
BVAF_344          CDS       T01398                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BVAF_344 (gpmA)
   01230 Biosynthesis of amino acids
    BVAF_344 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVAF_344 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BVAF_344 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVAF_344 (gpmA)
Enzymes [BR:bva01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BVAF_344 (gpmA)
Exosome [BR:bva04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BVAF_344 (gpmA)
  Exosomal proteins of melanoma cells
   BVAF_344 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388397..389104
Genome map
AA seq 235 aa AA seqDB search
MNINKIQVVFVRHGESEWNKNNRFTGWVDIDLSNRGHLEAKQAGQLLKKNNFIFTYGYTS
VLKRAIHTLWIILDQLNQAWLPIKKSWKLNERHYGALQGLNKDEAIKKYGYETIQKWRRN
FKDIPPGRVKNKNLITEIDDIHYNIMGIHNLPNGESLELTANRVIPYWKNVIIPDINNNN
HTIIIVTHGNSIRAMIKFLNCLSETEISKVEVPTGTPLIYEFNRDFQPIKHYYLS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaataaaattcaagtagtatttgtcagacatggagaaagtgaatggaataaa
aataatcgatttactggatgggttgatattgatttatcaaacagaggtcatcttgaagcg
aaacaagctggtcaattacttaaaaagaataattttatctttacttacggatatacttct
gttttaaaaagagcgatacacactttatggataatcttagatcaactaaatcaagcatgg
ctaccaataaaaaaatcttggaaattaaatgaacgtcattatggagctttacaaggatta
aataaagatgaagctataaaaaaatacggttatgaaacaattcaaaaatggcgccgtaat
tttaaagatatccctccaggtagggtaaaaaataaaaatctaattacagaaatagatgac
attcattacaacattatgggaattcataatctccctaatggagaaagtttggagttaact
gcaaatagagttattccatattggaaaaacgttattattcctgacatcaataataataac
catacgattattatcgtcactcatggaaattcaataagagcaatgataaaatttttaaac
tgtttaagtgaaactgaaatttctaaagttgaagttcctaccgggaccccattaatatat
gaatttaatcgtgattttcaacctataaaacattattatttatcttga

DBGET integrated database retrieval system