KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_430Help
Entry
BVAF_430          CDS       T01398                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01130  Biosynthesis of antibiotics
bva01230  Biosynthesis of amino acids
Module
bva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVAF_430 (trpC)
Enzymes [BR:bva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BVAF_430 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BVAF_430 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADV33819
UniProt: E8Q6C5
Position
479388..480776
Genome map
AA seq 462 aa AA seqDB search
MPNTILNQIISYKKNWILNQKYYLSIDKLKTNIKNSKRSFYNTLLLAHRNNHTIFILEYK
VASPSKNIICNNPDLVKIIHIYKKYASIISVVTDEKYFHGNFDNLVQISNMTTQPILCKD
FFISEWQIYFARLHQADAILLMLSVIDDNTYRKLSYIAHSLNMGILTEITNSNELQRAIK
LNAKIIGINNRNLNDLSIDLNRTINLSPNIPDSIIKISESGITNHYHIKKLKRYVHGFLI
GTTLMSSSNYLDTAIKKLVLGENKICGLTRIEDAEVSYESGAIYGGLIFVNYSPRFINIK
NAQKIISAIPNLNYVGVFQNDLILNIVNIVRILNLSAIQLHGTENQNYIDKLRTQLPHTC
QIWKSINMNNQTPYTSNLLHIDRYLLDNKQGGSGKTFNWGKLSFTNIPLNKSILAGGLTI
NNCSKAAKIDCVGLDFNSGIEIQPGIKNHQSILKIFQILRIY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacacaattctcaatcaaattatatcatataaaaaaaactggatcttaaatcaa
aaatattatttatctattgataaattgaagactaacataaaaaatagtaaacgtagtttc
tataacaccttattattagctcatcgtaacaaccacactattttcatattagaatacaaa
gtagcttcaccatcaaaaaatattatttgcaataatcccgatcttgttaaaattattcat
atttacaaaaaatatgcttcaattatttccgtagtaactgatgaaaaatattttcatgga
aattttgataatttagtccaaataagtaatatgacaacacaacctatattatgcaaagat
ttctttatttcagaatggcaaatttattttgctcgattacatcaagcagatgcaatttta
ttaatgttatctgttatagatgataatacttatcgtaaactttcgtatattgcacattca
ttaaatatgggcattcttacagaaataactaatagcaatgaattacaaagagctataaaa
ttaaatgcaaaaattattggaataaataaccgaaacttaaatgacttatctattgattta
aatcgtactattaatttaagccccaatatccctgattcaattatcaaaattagtgaatct
gggatcactaatcactatcacataaagaaactaaaacgttacgttcatggatttttaatc
ggaacaactttaatgtcatcttcaaattatttagatacagcaattaaaaaattagtatta
ggagaaaataaaatatgtggacttactcgaattgaagatgcagaagtttcttatgaatca
ggagctatatatggaggacttatttttgttaactattccccgcgttttataaatataaaa
aatgctcaaaagatcatatctgcaataccaaatttaaattatgttggggtttttcaaaac
gatcttattctaaatattgtaaatatagtaaggatattaaatttatccgctattcaattg
cacggaacagaaaatcaaaattatattgataaattacgcactcaattaccacatacctgt
caaatatggaaaagtattaatatgaataatcagacaccatatacatctaacttattacat
attgatcgatatttattagataacaaacaaggaggaagtggaaaaacctttaattgggga
aaattatcatttacaaacataccattaaacaaatcaattttagcaggaggtttaacaata
aataactgctccaaagcagcaaaaatagattgcgtgggtttagattttaattcaggaata
gaaattcaacctggcattaaaaatcatcaatcaattttaaaaatatttcaaatattacgt
atatattaa

DBGET integrated database retrieval system