KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_430Help
Entry
BVAF_430          CDS       T01398                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVAF_430 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVAF_430 (trpC)
Enzymes [BR:bva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BVAF_430 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     BVAF_430 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479388..480776
Genome map
AA seq 462 aa AA seqDB search
MPNTILNQIISYKKNWILNQKYYLSIDKLKTNIKNSKRSFYNTLLLAHRNNHTIFILEYK
VASPSKNIICNNPDLVKIIHIYKKYASIISVVTDEKYFHGNFDNLVQISNMTTQPILCKD
FFISEWQIYFARLHQADAILLMLSVIDDNTYRKLSYIAHSLNMGILTEITNSNELQRAIK
LNAKIIGINNRNLNDLSIDLNRTINLSPNIPDSIIKISESGITNHYHIKKLKRYVHGFLI
GTTLMSSSNYLDTAIKKLVLGENKICGLTRIEDAEVSYESGAIYGGLIFVNYSPRFINIK
NAQKIISAIPNLNYVGVFQNDLILNIVNIVRILNLSAIQLHGTENQNYIDKLRTQLPHTC
QIWKSINMNNQTPYTSNLLHIDRYLLDNKQGGSGKTFNWGKLSFTNIPLNKSILAGGLTI
NNCSKAAKIDCVGLDFNSGIEIQPGIKNHQSILKIFQILRIY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacacaattctcaatcaaattatatcatataaaaaaaactggatcttaaatcaa
aaatattatttatctattgataaattgaagactaacataaaaaatagtaaacgtagtttc
tataacaccttattattagctcatcgtaacaaccacactattttcatattagaatacaaa
gtagcttcaccatcaaaaaatattatttgcaataatcccgatcttgttaaaattattcat
atttacaaaaaatatgcttcaattatttccgtagtaactgatgaaaaatattttcatgga
aattttgataatttagtccaaataagtaatatgacaacacaacctatattatgcaaagat
ttctttatttcagaatggcaaatttattttgctcgattacatcaagcagatgcaatttta
ttaatgttatctgttatagatgataatacttatcgtaaactttcgtatattgcacattca
ttaaatatgggcattcttacagaaataactaatagcaatgaattacaaagagctataaaa
ttaaatgcaaaaattattggaataaataaccgaaacttaaatgacttatctattgattta
aatcgtactattaatttaagccccaatatccctgattcaattatcaaaattagtgaatct
gggatcactaatcactatcacataaagaaactaaaacgttacgttcatggatttttaatc
ggaacaactttaatgtcatcttcaaattatttagatacagcaattaaaaaattagtatta
ggagaaaataaaatatgtggacttactcgaattgaagatgcagaagtttcttatgaatca
ggagctatatatggaggacttatttttgttaactattccccgcgttttataaatataaaa
aatgctcaaaagatcatatctgcaataccaaatttaaattatgttggggtttttcaaaac
gatcttattctaaatattgtaaatatagtaaggatattaaatttatccgctattcaattg
cacggaacagaaaatcaaaattatattgataaattacgcactcaattaccacatacctgt
caaatatggaaaagtattaatatgaataatcagacaccatatacatctaacttattacat
attgatcgatatttattagataacaaacaaggaggaagtggaaaaacctttaattgggga
aaattatcatttacaaacataccattaaacaaatcaattttagcaggaggtttaacaata
aataactgctccaaagcagcaaaaatagattgcgtgggtttagattttaattcaggaata
gaaattcaacctggcattaaaaatcatcaatcaattttaaaaatatttcaaatattacgt
atatattaa

DBGET integrated database retrieval system