KEGG   Candidatus Blochmannia vafer: BVAF_430Help
Entry
BVAF_430          CDS       T01398                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
bva  Candidatus Blochmannia vafer
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bva01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bva00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
479388..480776
Genome map
AA seq 462 aa AA seqDB search
MPNTILNQIISYKKNWILNQKYYLSIDKLKTNIKNSKRSFYNTLLLAHRNNHTIFILEYK
VASPSKNIICNNPDLVKIIHIYKKYASIISVVTDEKYFHGNFDNLVQISNMTTQPILCKD
FFISEWQIYFARLHQADAILLMLSVIDDNTYRKLSYIAHSLNMGILTEITNSNELQRAIK
LNAKIIGINNRNLNDLSIDLNRTINLSPNIPDSIIKISESGITNHYHIKKLKRYVHGFLI
GTTLMSSSNYLDTAIKKLVLGENKICGLTRIEDAEVSYESGAIYGGLIFVNYSPRFINIK
NAQKIISAIPNLNYVGVFQNDLILNIVNIVRILNLSAIQLHGTENQNYIDKLRTQLPHTC
QIWKSINMNNQTPYTSNLLHIDRYLLDNKQGGSGKTFNWGKLSFTNIPLNKSILAGGLTI
NNCSKAAKIDCVGLDFNSGIEIQPGIKNHQSILKIFQILRIY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacacaattctcaatcaaattatatcatataaaaaaaactggatcttaaatcaa
aaatattatttatctattgataaattgaagactaacataaaaaatagtaaacgtagtttc
tataacaccttattattagctcatcgtaacaaccacactattttcatattagaatacaaa
gtagcttcaccatcaaaaaatattatttgcaataatcccgatcttgttaaaattattcat
atttacaaaaaatatgcttcaattatttccgtagtaactgatgaaaaatattttcatgga
aattttgataatttagtccaaataagtaatatgacaacacaacctatattatgcaaagat
ttctttatttcagaatggcaaatttattttgctcgattacatcaagcagatgcaatttta
ttaatgttatctgttatagatgataatacttatcgtaaactttcgtatattgcacattca
ttaaatatgggcattcttacagaaataactaatagcaatgaattacaaagagctataaaa
ttaaatgcaaaaattattggaataaataaccgaaacttaaatgacttatctattgattta
aatcgtactattaatttaagccccaatatccctgattcaattatcaaaattagtgaatct
gggatcactaatcactatcacataaagaaactaaaacgttacgttcatggatttttaatc
ggaacaactttaatgtcatcttcaaattatttagatacagcaattaaaaaattagtatta
ggagaaaataaaatatgtggacttactcgaattgaagatgcagaagtttcttatgaatca
ggagctatatatggaggacttatttttgttaactattccccgcgttttataaatataaaa
aatgctcaaaagatcatatctgcaataccaaatttaaattatgttggggtttttcaaaac
gatcttattctaaatattgtaaatatagtaaggatattaaatttatccgctattcaattg
cacggaacagaaaatcaaaattatattgataaattacgcactcaattaccacatacctgt
caaatatggaaaagtattaatatgaataatcagacaccatatacatctaacttattacat
attgatcgatatttattagataacaaacaaggaggaagtggaaaaacctttaattgggga
aaattatcatttacaaacataccattaaacaaatcaattttagcaggaggtttaacaata
aataactgctccaaagcagcaaaaatagattgcgtgggtttagattttaattcaggaata
gaaattcaacctggcattaaaaatcatcaatcaattttaaaaatatttcaaatattacgt
atatattaa

DBGET integrated database retrieval system