KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_431Help
Entry
BVAF_431          CDS       T01398                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00260  Glycine, serine and threonine metabolism
bva00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bva01100  Metabolic pathways
bva01110  Biosynthesis of secondary metabolites
bva01130  Biosynthesis of antibiotics
bva01230  Biosynthesis of amino acids
Module
bva_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVAF_431 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVAF_431 (trpB)
Enzymes [BR:bva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVAF_431 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADV33820
UniProt: E8Q6C6
Position
480810..482009
Genome map
AA seq 399 aa AA seqDB search
MMQKKLTSYFGEFGGMYVPQILIPTLIELEKEFISSQNDPVFQKELKALLKNYAGRPTPL
TLCRNLTHGTHSKLYLKREDLVHGGSHKTNQVLGQALLAKRMHKTDIIAETGAGQHGVAV
SIVAALLKLKCRIYMGQKDINRQKSNVLRMKLMGSQVIPVYHGSATLKDACNEAMREWSK
TYQYTHYMLGTIAGPHPFPTIVKEFQRIIGIETFEQIQNFEKRLPDSIIACIGGGSNAIG
IFSSFLDIPSVQLLGVEAGGLGLNTEYHGAALQCGDTGIYFGMKAPILQTEEGQIKNSYS
IAAGLDFPSVGPEHAYLKKINRVKYVSVSDQDAIYAFQQLSIHEGIIPALESAHALAYAL
KIINQNPNKKQILIVNLSGRGDKDIITVNNQIHNKEKLT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaaaaattaacttcctacttcggagaatttgggggtatgtatgtccctcaa
atactaataccaacactaatagaattagaaaaagaatttatatcctcccaaaatgatcca
gtttttcagaaagaactcaaagcattattaaaaaattacgcgggccgacctactcctcta
actttatgtagaaatttgactcatggaacacatagtaagctatatttaaaacgtgaagat
ttagttcatggaggatctcataaaacaaatcaagtattaggacaagcattattagcgaaa
cgcatgcataaaacagatattatagctgaaactggagcaggtcaacatggggttgctgtt
tccattgttgcagctcttttaaaattaaaatgccgaatttacatgggtcaaaaagacata
aatcgacaaaaatctaatgtgttacgcatgaaacttatgggaagccaagttattcctgta
tatcatggttctgctacattaaaagatgcatgcaatgaagcaatgcgagaatggtcaaaa
acttatcaatatactcattatatgttaggaacgattgcaggccctcatccattccctaca
attgtaaaagaatttcaacgcatcattggtatagaaacattcgaacaaatacaaaatttt
gaaaaaagactaccagattctattattgcttgtataggtggagggtccaatgctattgga
atattttccagttttcttgacattccatccgttcaactattaggagtagaagcagggggg
ttagggttaaatacagaatatcatggagcagctttacaatgcggagatacaggaatttat
tttggaatgaaagctcctattttgcaaaccgaagaaggtcaaataaaaaactcctattct
attgcagcaggattagattttccttccgttggaccagagcacgcttatttaaaaaaaatt
aacagagtaaagtatgtatctgtatcagatcaagatgcaatatatgcattccaacaattg
tctattcatgaaggcataattccagctttagaatcagctcatgcactagcatatgcttta
aaaataattaaccagaacccaaataaaaaacaaattttaatagtgaatttatctggtcgg
ggagacaaagacattataacagttaacaatcaaatacataacaaagagaaattaacatga

DBGET integrated database retrieval system