KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_431Help
Entry
BVAF_431          CDS       T01398                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVAF_431 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVAF_431 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVAF_431 (trpB)
Enzymes [BR:bva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVAF_431 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480810..482009
Genome map
AA seq 399 aa AA seqDB search
MMQKKLTSYFGEFGGMYVPQILIPTLIELEKEFISSQNDPVFQKELKALLKNYAGRPTPL
TLCRNLTHGTHSKLYLKREDLVHGGSHKTNQVLGQALLAKRMHKTDIIAETGAGQHGVAV
SIVAALLKLKCRIYMGQKDINRQKSNVLRMKLMGSQVIPVYHGSATLKDACNEAMREWSK
TYQYTHYMLGTIAGPHPFPTIVKEFQRIIGIETFEQIQNFEKRLPDSIIACIGGGSNAIG
IFSSFLDIPSVQLLGVEAGGLGLNTEYHGAALQCGDTGIYFGMKAPILQTEEGQIKNSYS
IAAGLDFPSVGPEHAYLKKINRVKYVSVSDQDAIYAFQQLSIHEGIIPALESAHALAYAL
KIINQNPNKKQILIVNLSGRGDKDIITVNNQIHNKEKLT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaaaaaattaacttcctacttcggagaatttgggggtatgtatgtccctcaa
atactaataccaacactaatagaattagaaaaagaatttatatcctcccaaaatgatcca
gtttttcagaaagaactcaaagcattattaaaaaattacgcgggccgacctactcctcta
actttatgtagaaatttgactcatggaacacatagtaagctatatttaaaacgtgaagat
ttagttcatggaggatctcataaaacaaatcaagtattaggacaagcattattagcgaaa
cgcatgcataaaacagatattatagctgaaactggagcaggtcaacatggggttgctgtt
tccattgttgcagctcttttaaaattaaaatgccgaatttacatgggtcaaaaagacata
aatcgacaaaaatctaatgtgttacgcatgaaacttatgggaagccaagttattcctgta
tatcatggttctgctacattaaaagatgcatgcaatgaagcaatgcgagaatggtcaaaa
acttatcaatatactcattatatgttaggaacgattgcaggccctcatccattccctaca
attgtaaaagaatttcaacgcatcattggtatagaaacattcgaacaaatacaaaatttt
gaaaaaagactaccagattctattattgcttgtataggtggagggtccaatgctattgga
atattttccagttttcttgacattccatccgttcaactattaggagtagaagcagggggg
ttagggttaaatacagaatatcatggagcagctttacaatgcggagatacaggaatttat
tttggaatgaaagctcctattttgcaaaccgaagaaggtcaaataaaaaactcctattct
attgcagcaggattagattttccttccgttggaccagagcacgcttatttaaaaaaaatt
aacagagtaaagtatgtatctgtatcagatcaagatgcaatatatgcattccaacaattg
tctattcatgaaggcataattccagctttagaatcagctcatgcactagcatatgcttta
aaaataattaaccagaacccaaataaaaaacaaattttaatagtgaatttatctggtcgg
ggagacaaagacattataacagttaacaatcaaatacataacaaagagaaattaacatga

DBGET integrated database retrieval system