KEGG   Candidatus Blochmannia vafer: BVAF_432Help
Entry
BVAF_432          CDS       T01398                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BVAF_432 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BVAF_432 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BVAF_432 (trpA)
Enzymes [BR:bva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BVAF_432 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482006..482824
Genome map
AA seq 272 aa AA seqDB search
MNRYQKLFTNLHQQKLGAFVPFITVGDPDPDSFINIIDTLIEAGADALELGIPFSDPLSD
GPAIQKSMERAFKSGINFFLCLKLINDIRSKYPHLPIGLLIYANLIMKHGIKNFYCNCSK
LNIDSVLIPDLPIEESSLFYKTAMYYKIAHIFICPPNANFNLIKQITNQGQGYIYLLSRP
GITGINNDEFNITVLNMLIQHIKQQKRVLPILQGFGIHTPDQAHQSLLSGTSGVIIGSAI
ANIIEDNLSSNPIILLTQLKKLTHLIKISMKL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttatcaaaaattattcactaatttacatcagcaaaaacttggggcttttgtc
ccatttattactgttggagatcctgaccccgattcttttataaatattatagatacgtta
atagaagctggagctgatgctttagaattaggaataccattttcagatcctttatctgat
ggtcctgcaatacaaaaaagcatggaacgtgcttttaaatctgggatcaatttttttctt
tgtctaaaattaatcaatgatattagatctaaatatcctcatttacccattgggttatta
atttatgccaatttaattatgaaacatggcataaagaacttttactgtaattgctcaaaa
cttaatatagattctgtattaatcccagacctacctatagaagaaagttctctattttat
aaaactgctatgtactataaaatagctcatatctttatttgccctcctaatgccaatttt
aatttaattaaacaaatcacaaatcaaggacaaggatatatttatctattatctcggcca
ggcataactggtattaataatgatgaatttaatatcaccgtattaaatatgttgattcaa
catataaaacaacaaaaacgagttctaccaatattacaaggattcgggatacatacccca
gaccaagcccaccaatctttactatcaggaacttctggggttattataggatctgcaatt
gctaatatcattgaagataatctctcttctaatcctattatattattaacacaattaaaa
aaattaactcatttaataaaaatatctatgaaactataa

DBGET integrated database retrieval system