KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_473Help
Entry
BVAF_473          CDS       T01398                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVAF_473 (folE)
Enzymes [BR:bva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BVAF_473 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(531829..532494)
Genome map
AA seq 221 aa AA seqDB search
MSTLTQEALLVRDALLIQGLENPVIELDIDNRIRMNQIEDHMAAIMYLLKLNLNNDSLFH
TPKRIAKMYVEEIFSGLDYSNFPKISVIKNTMKINEMITVRNINITSICEHHFIIFNGKA
TVSYIPENSVIGLSKINKIVQFFSKRPQLQERLTQQIFLALQTLLNTNNVAIFIDAVHYC
VKARGIHDITSTTNTTALGGLFKSNENIRREFIHTITYTNS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctacattaactcaagaggcgttgttggtacgagatgctttgttaattcaaggattg
gaaaatcctgtaattgaattagatatagataatagaattcgtatgaatcaaattgaagat
catatggcagctattatgtatcttcttaagttaaatttaaacaatgatagtctttttcat
actccaaaacgtattgcaaaaatgtatgtggaagaaattttttctgggttagattattca
aattttcctaaaatttcagttataaaaaatacaatgaaaataaatgagatgattacggta
cgtaatatcaatattactagtatatgtgaacatcattttattatttttaatggaaaagct
actgtatcatatattccagaaaatagtgtaattggtttatcaaaaattaataaaatagta
caatttttttctaagaggccgcaattgcaagaacgattaactcaacaaatttttttagca
ttacaaacgttattgaatactaataatgtagcaatatttatcgatgctgtgcattattgt
gtcaaagcaagagggatacatgatattacaagtactacaaatactactgcattgggagga
ttatttaaatctaatgaaaatattcgaagagaatttattcatactattacatatactaat
agttaa

DBGET integrated database retrieval system